Property Summary

NCBI Gene PubMed Count 5
PubMed Score 66.07

Knowledge Summary


No data available


  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2346 3.17 1.6

AA Sequence

TPFRISVTSSCFVQNTLTKLLKDRRKMQTVQCATAQETS                                    71 - 109

Text Mined References (6)

PMID Year Title
17803354 2007 The diploid genome sequence of an individual human.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12676563 2003 BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461691 2002 New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
7895173 1995 BAGE: a new gene encoding an antigen recognized on human melanomas by cytolytic T lymphocytes.