Property Summary

NCBI Gene PubMed Count 92
PubMed Score 601.81
PubTator Score 132.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 9.7e-06
osteosarcoma -1.443 2.2e-04
astrocytoma 1.100 2.0e-02
medulloblastoma 1.100 4.2e-06
ovarian cancer 1.900 1.2e-07

Gene RIF (61)

PMID Text
26663859 The observations suggest a mechanism whereby the BAG6 ubiquitin-linked domain provides a platform for discriminating substrates with shorter hydrophobicity stretches as a signal for defective proteins.
26598275 we found BAG6 to be dispensable in antigen processing
26153132 BAG6 co-localizes with HSPA2 in huinan testicular germ cells and epididymal spermatozoa, moving from the equator to the anterior head during capacitation and stably interacting with HSPA2. In zona pellucida binding defect infertility, BAG6 is lacking.
25884493 BAG6 rs3117582 SNP was associated with non small cell lung cancer in the Norwegian subjects and the combined Croatian-Norwegian subjects corroborating the earlier finding that BAG6 rs3117582 SNP was associated with lung cancer in Europeans.
25535373 Both TRC35 and Ubl4A have distinct C-terminal binding sites on Bag6 defining a minimal Bag6 complex.
25430685 This meta-analysis suggested that HLA-B-associated transcript 3 polymorphisms are risk factors for lung cancer.
25415308 Data show that molecular chaperone BAG6_ubiquitin-like domain (UBL) and ubiquitin-like 4A UBL4A_UBL compete for the same binding site on N-terminal dimerisation domain of SGTA protein (SGTA_NT).
25231575 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
25111513 The BAT2/BAT3 polymorphisms and specifically the A/C haplotype may represent a novel immunogenetic factor associated with graft rejection in patients undergoing allo-HSCT.
25091272 Tim-3/Gal-9 interaction favors apoptosis of MBP-specific T lymphocytes in benign multiple sclerosis; this process is reduced in PPMS by the up-regulation of Bat3
24989925 This meta-analysis suggested that BAT3 polymorphisms contributed the development of lung cancer.
24981174 RNF126 is recruited to the N-terminal Ubl domain of Bag6 and preferentially ubiquitinates juxtahydrophobic lysine residues on Bag6-associated clients.
24806960 Exogenous BAG6 perturbs the function of the BAG6 complex at a stage subsequent to substrate recognition and polyubiquitylation, most likely the BAG6-dependent delivery of OpD to the proteasome.
24625963 VNTR in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP are associated with susceptibility to tuberculosis
24594942 show that endogenous dislocation clients are captured specifically in association with the cytosolic chaperone BAG6, or retrieved en masse via their glycan handle
24133212 we show for the first time that BAG-6(686-936) comprises a subdomain of BAG-6, which is sufficient for receptor docking and inhibition of NKp30-dependent NK cell cytotoxicity as part of a tumor immune escape mechanism
23900548 Bag6, a protein in the TRC pathway that is also responsible for the degradation of mislocalized proteins, is not only involved in core particle assembly but also has a key role in efficient regulatory particle assembly.
23723067 Data indicate that BCL2-associated athanogene 6 (BAG6) appears to be the central component for the process, as depletion of BAG6 leads to the loss of both UBL4A and GET4 proteins and resistance to cell killing by DNA-damaging agents.
23665563 Data indicate that the Bag6-Ubl4A-Trc35 complex is localized to the endoplasmic reticulum (ER) membrane to regulate ER-associated degradation (ERAD).
23246001 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23129660 A BAG6/SGTA cycle operates during protein maturation and quality control in the cytosol.
23077592 our results suggest an essential role for AIF and its binding partner Scythe in the pathway leading to apoptotic corpse clearance.
22863785 Bat3 promotes T cell responses and autoimmunity by repressing Tim-3-mediated cell death and exhaustion.
22641691 Aberrant enhancement of YWK-II/APLP2 by nuclear export of Bat3 may play a role in cancer development by inhibiting cell apoptosis.
22558287 Cell type-specific subcellular expression of BAT3 suggests distinct functions in the cytosol and in the nucleus.
22373577 These findings identify a novel role for Bat3 in regulating DOT1L function, which plays a critical role in DNA damage response.
22285488 Data show that cleavage of Scythe by caspase-3 occurs after activation of both the extrinsic (i.e. Fas/APO-1-mediated) and the intrinsic (i.e. staurosporine-induced) apoptosis pathway.
22190034 HIV-1 Vif is identified to have a physical interaction with BCL2-associated athanogene 6 (BAG6; BAT3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22174835 BAT3, a cytosolic chaperone, is recruited to the site of dislocation through its interaction with Derlin2.
21940994 We present a mechanism explaining how parallel IFNgamma-mediated regulation of CIITA and of its chaperone BAT3 controls the level of components of the HLA class II processing pathway.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20713601 Data suggest that BAG-6 is necessary for ubiquitin-mediated degradation of newly synthesized defective polypeptides.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626023 Results suggest BAT2 -8671, BAT3 8854, and BAT5 22655, 9569 SNPs as well as BAT haplotypes (ATTGTG and ATCATG) might be associated with higher Kawasaki disease susceptibility and coronary artery aneurysm formation.
20626023 Observational study of gene-disease association. (HuGE Navigator)
20587610 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20385987 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20106900 Observational study of gene-disease association. (HuGE Navigator)
20098615 Observational study of gene-disease association. (HuGE Navigator)
19955392 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19837266 Observational study of gene-disease association. (HuGE Navigator)
19357808 The HSP70-driven degradation of BAG6, following the BAG6-dependent accumulation of HSP70, could allow the protein-refolding activity of HSP70 and limit the extent of its induction.
19242354 Observational study of gene-disease association. (HuGE Navigator)
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19018758 colocalization of PBF and Scythe/BAT3 in the nucleus might be an important factor for survival of osteosarcoma cells.
18978787 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of BCL2-associated athanogene 6 (BAG6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18852879 NKp30-mediated NK cells/dendritic cells cross talk resulting either in iDC killing or maturation was BAT3-dependent
18835879 Observational study of gene-disease association. (HuGE Navigator)
18765639 BORIS acts as a platform upon which BAT3 and SET1A assemble and exert effects upon chromatin structure and gene expression.
18757527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18056262 Scythe regulates apoptosis-inducing factor stability during endoplasmic reticulum stress-induced apoptosis
18055229 HLA-B-associated transcript 3 (BAT3) was released from tumor cells, bound directly to NKp30, and engaged NKp30 on NK cells. BAT3 triggered NKp30-mediated cytotoxicity and was necessary for tumor rejection in a multiple myeloma model.
17672918 occurrence of an unusual TG 3' splice site in intron 6
17403783 Bat3 is a novel and essential regulator of p53-mediated responses to genotoxic stress, and that Bat3 controls DNA damage-induced acetylation of p53.
16954377 MRK phosphorylates Scythe at T1080 in vitro as determined by site-directed mutagenesis and mass spectrometry, supporting the consensus and suggesting Scythe as a physiological substrate for MRK.
16777091 Interaction of hSGT with Hsc70, Hsp70 or Bag-6/Bat-3/Scythe was demonstrated in prometaphase, thereby suggesting a possible role for complexes containing hSGT and distinct (co)-chaperones during mitosis.
14960581 Evidence indicates that casp3 activated by ricin acts on BAT3 at the caspase cleavage site, DEQD(1001) to release a C-terminal fragment designated CTF-131, which induces phosphatidylserine exposure, cell rounding, and chromatin condensation as ricin does

AA Sequence

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK      1 - 70
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL     71 - 140
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVT    141 - 210
PEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVL    211 - 280
QELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACT    281 - 350
PPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV    351 - 420
ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQ    421 - 490
QVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTP    491 - 560
GMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASP    561 - 630
TITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEF    631 - 700
FTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVML    701 - 770
LHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE    771 - 840
FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSL    841 - 910
VSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTA    911 - 980
EEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKR    981 - 1050
RKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQR   1051 - 1120
FPNAQRAFADDP                                                             1121 - 1132
//

Text Mined References (107)

PMID Year Title
26663859 2016 A conserved island of BAG6/Scythe is related to ubiquitin domains and participates in short hydrophobicity recognition.
26598275 2016 Chaperone BAG6 is dispensable for MHC class I antigen processing and presentation.
26153132 2015 Novel characterization of the HSPA2-stabilizing protein BAG6 in human spermatozoa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25884493 2015 Association of the FAM46A gene VNTRs and BAG6 rs3117582 SNP with non small cell lung cancer (NSCLC) in Croatian and Norwegian populations.
25535373 2015 Bag6 complex contains a minimal tail-anchor-targeting module and a mock BAG domain.
25430685 2014 Effect of HLA-B-associated transcript 3 polymorphisms on lung cancer risk: a meta-analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25415308 2014 Solution structure of the SGTA dimerisation domain and investigation of its interactions with the ubiquitin-like domains of BAG6 and UBL4A.
25231575 2015 Susceptibility to large-joint osteoarthritis (hip and knee) is associated with BAG6 rs3117582 SNP and the VNTR polymorphism in the second exon of the FAM46A gene on chromosome 6.
25111513 2014 BAT2 and BAT3 polymorphisms as novel genetic risk factors for rejection after HLA-related SCT.
25091272 2014 A role for the TIM-3/GAL-9/BAT3 pathway in determining the clinical phenotype of multiple sclerosis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24989925 2014 BAT3 rs1052486 and rs3117582 polymorphisms are associated with lung cancer risk: a meta-analysis.
24981174 2014 Cytosolic quality control of mislocalized proteins requires RNF126 recruitment to Bag6.
24806960 2014 BAG6 regulates the quality control of a polytopic ERAD substrate.
24625963 2014 Association of variable number of tandem repeats in the coding region of the FAM46A gene, FAM46A rs11040 SNP and BAG6 rs3117582 SNP with susceptibility to tuberculosis.
24594942 2014 The chaperone BAG6 captures dislocated glycoproteins in the cytosol.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24133212 2013 A soluble fragment of the tumor antigen BCL2-associated athanogene 6 (BAG-6) is essential and sufficient for inhibition of NKp30 receptor-dependent cytotoxicity of natural killer cells.
23900548 2013 Involvement of Bag6 and the TRC pathway in proteasome assembly.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23723067 2013 Nuclear BAG6-UBL4A-GET4 complex mediates DNA damage signaling and cell death.
23665563 2013 A ubiquitin-like domain recruits an oligomeric chaperone to a retrotranslocation complex in endoplasmic reticulum-associated degradation.
23246001 2012 SGTA recognizes a noncanonical ubiquitin-like domain in the Bag6-Ubl4A-Trc35 complex to promote endoplasmic reticulum-associated degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129660 2012 SGTA antagonizes BAG6-mediated protein triage.
23077592 2012 AIF and Scythe (Bat3) regulate phosphatidylserine exposure and macrophage clearance of cells undergoing Fas (APO-1)-mediated apoptosis.
22863785 2012 Bat3 promotes T cell responses and autoimmunity by repressing Tim-3–mediated cell death and exhaustion.
22641691 2012 Regulation of apoptosis by Bat3-enhanced YWK-II/APLP2 protein stability.
22558287 2012 A novel BAT3 sequence generated by alternative RNA splicing of exon 11B displays cell type-specific expression and impacts on subcellular localization.
22373577 2012 Bat3 facilitates H3K79 dimethylation by DOT1L and promotes DNA damage-induced 53BP1 foci at G1/G2 cell-cycle phases.
22285488 2012 Scythe cleavage during Fas (APO-1)-and staurosporine-mediated apoptosis.
22174835 2011 BAT3 guides misfolded glycoproteins out of the endoplasmic reticulum.
21940994 2012 ?-Interferon-regulated chaperone governs human lymphocyte antigen class II expression.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21844665 2011 Common variants at the promoter region of the APOM confer a risk of rheumatoid arthritis.
21636303 2011 A ubiquitin ligase-associated chaperone holdase maintains polypeptides in soluble states for proteasome degradation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20713601 2010 BAG-6 is essential for selective elimination of defective proteasomal substrates.
20676083 2010 A ribosome-associating factor chaperones tail-anchored membrane proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626023 2010 Human lymphocyte antigen B-associated transcript 2, 3, and 5 polymorphisms and haplotypes are associated with susceptibility of Kawasaki disease and coronary artery aneurysm.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20547746 2010 E3 ubiquitin ligase activity and targeting of BAT3 by multiple Legionella pneumophila translocated substrates.
20516149 2010 Bat3 promotes the membrane integration of tail-anchored proteins.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20385987 2010 Interactions among genetic variants in apoptosis pathway genes, reflux symptoms, body mass index, and smoking indicate two distinct etiologic patterns of esophageal adenocarcinoma.
20106900 2010 International Lung Cancer Consortium: coordinated association study of 10 potential lung cancer susceptibility variants.
20098615 2010 Application of gene network analysis techniques identifies AXIN1/PDIA2 and endoglin haplotypes associated with bicuspid aortic valve.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19955392 2010 Role of 5p15.33 (TERT-CLPTM1L), 6p21.33 and 15q25.1 (CHRNA5-CHRNA3) variation and lung cancer risk in never-smokers.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19837266 2009 TP53 R72P and MDM2 SNP309 polymorphisms in modification of childhood acute lymphoblastic leukemia susceptibility.
19836008 2009 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19654303 2009 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19357808 2009 Sequential interplay between BAG6 and HSP70 upon heat shock.
19242354 2009 The tumor necrosis factor polymorphism TNF (-308) is associated with susceptibility to meningococcal sepsis, but not with lethality.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
19018758 2009 Scythe/BAT3 regulates apoptotic cell death induced by papillomavirus binding factor in human osteosarcoma.
18978787 2008 Common 5p15.33 and 6p21.33 variants influence lung cancer risk.
18852879 2008 Dendritic cells release HLA-B-associated transcript-3 positive exosomes to regulate natural killer function.
18835879 2008 Fine mapping of the MHC Class III region demonstrates association of AIF1 and rheumatoid arthritis.
18765639 2008 BAT3 and SET1A form a complex with CTCFL/BORIS to modulate H3K4 histone dimethylation and gene expression.
18757527 2008 Apoptosis gene polymorphisms, age, smoking and the risk of non-small cell lung cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
18056262 2008 Scythe regulates apoptosis-inducing factor stability during endoplasmic reticulum stress-induced apoptosis.
18055229 2007 Human leukocyte antigen-B-associated transcript 3 is released from tumor cells and engages the NKp30 receptor on natural killer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
17403783 2007 HLA-B-associated transcript 3 (Bat3)/Scythe is essential for p300-mediated acetylation of p53.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16954377 2006 Identification of yin-yang regulators and a phosphorylation consensus for male germ cell-associated kinase (MAK)-related kinase.
16777091 2006 Human SGT interacts with Bag-6/Bat-3/Scythe and cells with reduced levels of either protein display persistence of few misaligned chromosomes and mitotic arrest.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15231747 2004 A protein interaction framework for human mRNA degradation.
14960581 2004 Ricin triggers apoptotic morphological changes through caspase-3 cleavage of BAT3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11587531 2001 Human Scythe contains a functional nuclear localization sequence and remains in the nucleus during staurosporine-induced apoptosis.
11584289 2001 Molecular chaperone targeting and regulation by BAG family proteins.
11230127 2001 Reversible inhibition of Hsp70 chaperone function by Scythe and Reaper.
10390159 1999 Cloning and characterization of rat BAT3 cDNA.
2911734 1989 A new cluster of genes within the human major histocompatibility complex.
2813433 1989 Human major histocompatibility complex contains a minimum of 19 genes between the complement cluster and HLA-B.
2156268 1990 A gene pair from the human major histocompatibility complex encodes large proline-rich proteins with multiple repeated motifs and a single ubiquitin-like domain.
1684176 1991 Novel detection of restriction fragment length polymorphisms in the human major histocompatibility complex.