Property Summary

NCBI Gene PubMed Count 28
PubMed Score 23.72
PubTator Score 16.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
hepatocellular carcinoma -1.100 3.7e-05
astrocytic glioma -1.600 3.6e-02
psoriasis 1.100 9.2e-04
posterior fossa group B ependymoma -1.200 1.3e-04
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
glioblastoma -1.300 2.2e-06
tuberculosis and treatment for 6 months 2.200 1.8e-05
intraductal papillary-mucinous neoplasm ... 1.100 4.9e-03
adult high grade glioma -1.200 1.3e-02
subependymal giant cell astrocytoma -1.276 1.7e-02
ovarian cancer -1.300 4.5e-03

Synonym

Accession O95429 B4E217 O95818 BAG-4
Symbols SODD
BAG-4

Gene

PANTHER Protein Class (1)

PDB

1M62   1M7K  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (13)

PMID Text
25849655 SGK1.1 regulates gene transcription upon a different set of genes some of which participate in cell survival pathways (BAG-4) and others in intracellular vesicular traffic (Brox).
24737427 SODD over-expression might be correlated with the clinical classification, curative effect, and prognosis of ALL cells.
23190898 MicroRNA-26a is strongly downregulated in melanoma and induces cell death through repression of silencer of death domains (SODD).
20855536 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17605853 Vincristine induces Jurkat cell apoptosis by downregulating expression of SODD protein and priming the death receptor pathway.
17366557 results of analysis of the genome-wide scan data was a 20 cM region at 8p11-23 in which markers had LODs > or =1.0. Linkage and association analyses of these SNPs yield suggestive results for markers in FGFR1 and BAG4.
17178857 Gene induces transformed phenotype when overexpressed in a cancer breast cell line.
14559896 BAG-4 functions as a negative regulator for apobec-1-mediated apoB mRNA editing
12875962 These data confirm that silencer of death domains (SODD) and death receptor 3 (DR3) are expressed in a regulated manner during renal transplant rejection, and identify DR3 as a potential inducible mediator of tubular inflammation and injury.
12706861 SODD/BAG-4 is not only a silencer of TNFR1 but also a modulator of CD95 activity, regulating the balance of both death-promoting and -depressing signals
12017295 Altered signaling of TNFalpha-TNFR1 and SODD/BAG4 is responsible for radioresistance in human HT-R15 cells.

AA Sequence

MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGD      1 - 70
GYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTY     71 - 140
PPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPS    141 - 210
QNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPS    211 - 280
SGSPQSPPSPPVQQPKDSSYPYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN    281 - 350
ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL    351 - 420
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL                                     421 - 457
//

Text Mined References (33)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25849655 2015 The neuronal-specific SGK1.1 (SGK1_v2) kinase as a transcriptional modulator of BAG4, Brox, and PPP1CB genes expression.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24737427 2014 Significance of SODD expression in childhood acute lymphoblastic leukemia and its influence on chemotherapy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23190898 2013 MicroRNA-26a is strongly downregulated in melanoma and induces cell death through repression of silencer of death domains (SODD).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21712384 2011 Silencer of death domains (SODD) inhibits skeletal muscle and kidney enriched inositol 5-phosphatase (SKIP) and regulates phosphoinositide 3-kinase (PI3K)/Akt signaling to the actin cytoskeleton.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17605853 2007 [Effects of SODD and survivin on leukemia cell apoptosis induced by chemotherapeutic drugs].
17366557 2007 A genome-wide linkage scan for cleft lip and cleft palate identifies a novel locus on 8p11-23.
17178857 2006 Multiple interacting oncogenes on the 8p11-p12 amplicon in human breast cancer.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14559896 2003 Involvement of a chaperone regulator, Bcl2-associated athanogene-4, in apolipoprotein B mRNA editing.
12875962 2003 Expression of silencer of death domains and death-receptor-3 in normal human kidney and in rejecting renal transplants.
12706861 2003 Overexpression of the 'silencer of death domain', SODD/BAG-4, modulates both TNFR1- and CD95-dependent cell death pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12058034 2002 BAG4/SODD protein contains a short BAG domain.
12017295 Altered signaling of TNFalpha-TNFR1 and SODD/BAG4 is responsible for radioresistance in human HT-R15 cells.
11527400 2001 Isolation of Bcl-2 binding proteins that exhibit homology with BAG-1 and suppressor of death domains protein.
10508612 1999 Evidence for a function of death-receptor-related, death-domain-containing proteins in anoikis.
9915703 1999 Prevention of constitutive TNF receptor 1 signaling by silencer of death domains.
9873016 1999 An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.