Property Summary

NCBI Gene PubMed Count 29
PubMed Score 26.58
PubTator Score 16.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.3e-02
astrocytic glioma -1.600 3.6e-02
atypical teratoid / rhabdoid tumor -1.100 1.9e-04
ependymoma -1.100 2.4e-05
glioblastoma -1.300 2.2e-06
hepatocellular carcinoma -1.100 3.7e-05
intraductal papillary-mucinous neoplasm ... 1.100 4.9e-03
ovarian cancer -1.300 4.5e-03
psoriasis 1.100 9.2e-04
subependymal giant cell astrocytoma -1.276 1.7e-02
tuberculosis 1.600 4.2e-04

Gene RIF (14)

AA Sequence

MSALRRSGYGPSDGPSYGRYYGPGGGDVPVHPPPPLYPLRPEPPQPPISWRVRGGGPAETTWLGEGGGGD      1 - 70
GYYPSGGAWPEPGRAGGSHQEQPPYPSYNSNYWNSTARSRAPYPSTYPVRPELQGQSLNSYTNGAYGPTY     71 - 140
PPGPGANTASYSGAYYAPGYTQTSYSTEVPSTYRSSGNSPTPVSRWIYPQQDCQTEAPPLRGQVPGYPPS    141 - 210
QNPGMTLPHYPYGDGNRSVPQSGPTVRPQEDAWASPGAYGMGGRYPWPSSAPSAPPGNLYMTESTSPWPS    211 - 280
SGSPQSPPSPPVQQPKDSSYPYSQSDQSMNRHNFPCSVHQYESSGTVNNDDSDLLDSQVQYSAEPQLYGN    281 - 350
ATSDHPNNQDQSSSLPEECVPSDESTPPSIKKIIHVLEKVQYLEQEVEEFVGKKTDKAYWLLEEMLTKEL    351 - 420
LELDSVETGGQDSVRQARKEAVCKIQAILEKLEKKGL                                     421 - 457
//

Text Mined References (34)

PMID Year Title