Property Summary

NCBI Gene PubMed Count 143
PubMed Score 181.77
PubTator Score 147.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -1.200 2.3e-02
psoriasis 1.700 5.0e-04
osteosarcoma 2.219 7.8e-05
group 4 medulloblastoma -1.900 2.8e-03
astrocytoma 2.000 6.4e-03
medulloblastoma, large-cell -2.600 1.6e-03
primitive neuroectodermal tumor -1.100 6.4e-03
lung cancer -1.900 1.4e-05
active Crohn's disease 1.319 1.3e-02
ulcerative colitis 1.600 3.6e-08
lung carcinoma -1.200 2.6e-15
spina bifida -1.019 3.8e-02
ovarian cancer 2.000 3.6e-04
pituitary cancer -2.500 4.0e-07

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (116)

PMID Text
26707573 The present study, for the first time, examined the expression of central autophagy proteins BAG3 and p62 in testicular cancer
26655271 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10 and modulates cisplatin resistance.
26621836 Data indicate a tumor suppressor-like function of Bcl-2 associated athanogene 3 (BAG3) via direct interaction with glucose 6 phosphate dehydrogenase (G6PD) in hepatocellular carcinomas (HCCs) at the cellular level.
26545904 BAG3 is associated with Z-disc maintenance.
26541455 MiR-143 enhanced the tumor suppressive effect of shikonin partly through the regulation of BAG3 in glioblastoma stem cells.
26522614 BAG3 promotes pancreatic ductal adenocarcinoma growth by activating stromal macrophages.
26496431 our findings suggest the existence of a so-far unrecognized quality control mechanism involving BAG3, HSPB8 and p62/SQSTM1 for accurate remodelling of actin-based mitotic structures that guide spindle orientation.
26337083 Data show although no any significant differences between patient groups and lean subjects of proteins SYT4, BAG3, APOA1, and VAV3, except for VGF protein, there was a trend between the expression of these four genes and their protein levels.
26159920 BAG3 plays a key role in the processing of the nucleocytoplasmic shuttling of HSF1 upon heat stress
26158518 This newly described ERa-mediated and estrogen response element (ERE)-independent non-canonical autophagy pathway, which involves the function of BAG3 and provides stress resistance in our model systems.
26100943 BAG3 is a suitable target for combined therapies aimed at synergistically inducing apoptosis in bladder cancer.
25968616 Bis expression was higher in squamous cell carcinoma than in adenocarcinoma in Lung Cancer.
25889438 BAG3 protein loci is involved in the pathophysiology of systolic heart failure.
25766331 by demonstrating a critical role of NIK in mediating NF-kappaB activation and BAG3 induction upon ST80/Bortezomib cotreatment, our study provides novel insights into mechanisms of resistance to proteotoxic stress in RMS
25766323 Upon glucose stimulation BAG3 is phosphorylated by FAK and dissociates from SNAP-25 allowing the formation of the SNARE complex, destabilization of the F-actin network and insulin release.
25753466 The stress response protein BAG3 may be prognostic for death in patients with acutely decompensated heart failure.
25738313 To examine the relationships among BAG3, miR-29b and MMP2 in endometrioid adenocarcinoma cells.
25564440 The Hsp70-Bag3 interaction may be a promising, new target for anticancer therapy.
25483098 HIV-1 Tat protein is able to stimulate autophagy through increasing BAG3 levels in glial cells.
25483098 HIV-1 Tat upregulates the levels of BAG3 in human glioblastoma cells, and BAG3 silencing results in highly reducing Tat-induced upregulation of LC3-II and increasing the appearance of sub G0/G1 apoptotic cells
25448463 BAG3 carries highly penetrant DCM mutations that are associated with a worse prognosis characterized by earlier age of onset.
25412315 BIS targeting induces cellular senescence through the regulation of 14-3-3 zeta/STAT3/SKP2/p27 in glioblastoma cells.
25361773 Knockdown of BAG3 also significantly suppressed motion and invasion of HK2 cells mediated by FGF-2
25347739 Studies indicate that heat shock protein Hsp70 (Hsp70) regulates multiple pathways in cancer cells via interaction with Bcl2-associated athanogene 3 protein (BAG3) co-chaperone.
25273835 findings showed that the P209L mutation causes BAG3 to aggregate; proposed that the gradual loss of available BAG3(wt) and BAG3(P209L) proteins results in insufficiency leading to myofibrillar disintegration
25208129 BAG3 mutations should be considered even in cases with a mild phenotype or an adult onset
25204229 BAG3 induced autophagy is Beclin-1 independent
25175321 Findings reveal a novel role for BAG3 as host protein contributing to HPV18 E6-activated pro-survival strategies.
25149536 A subset of SCLCs over express BAG3 that exerts an anti-apoptotic effect resulting in resistance to chemotherapy.
25046115 BAG3 binding to the ubiquitinated clients occurs through the BAG domain, in competition with BAG1
25008357 BAG3 point mutations and large deletions are relatively frequent cause of dilated cardiomyopathy
24997994 Bag3-MVP is an important complex that regulates a potent prosurvival signaling pathway and contributes to chemotherapy resistance in breast cancer
24994713 Disrupts the Hsp70-Bag3 interaction.
24895585 The results suggested that the expression level of BAG3 and HIF-1 alpha is efficient prognostic parameters in patients with HCC after liver transplantation.
24722298 These results identify a subgroup of stage III melanoma patients, that is, patients with 2-3 positive lymph nodes, whose clinical behavior is influenced by the expression of the anti-apoptotic BAG3 protein.
24623017 Diminished levels of BAG3 protein may be associated with both familial and non-familial forms of dilated cardiomyopathy.
24577090 These results indicate BAG3 as a regulator of ZEB1 expression in epithelial-mesenchymal transition and as a regulator of metastasis in thyroid cancer cells.
24492285 BAG-3 expression correlated with increased HSP70 expression in a subset of systemic T cell lymphoma cases co-expressing the CD30 antigen.
24365746 BAG3 was overexpressed in hepatocellular carcinoma. BAG3 knockdown resulted in reduction in migration and invasion of cells, which was linked to reversion of epithelial-mesenchymal transition.
24318877 we measured the binding of human Hsp72 (HSPA1A) to BAG1, BAG2, BAG3, and the unrelated NEF Hsp105. These studies revealed a clear hierarchy of affinities: BAG3 > BAG1 > Hsp105 >> BAG2.
24286317 Bis knockdown resulted in a significant decrease in the migration and invasion of A172 glioma cells. Furthermore, Bis knockdown notably decreased TPA-induced matrix metalloproteinase-9 (MMP-9) activity and mRNA expression.
24140207 BAG3 stabilized JunD mRNA.
24080088 these results suggested that through direct interaction BAG3 could prevent the antiapoptotic effect of GRP78 upon genotoxic stress.
23978946 Data suggest that BAG3 expression is increased in chronic lymphocytic leukemia (CLL) cells compared with normal B-cells; knocking down BAG3 expression results in increased apoptosis and decreased cell migration in primary CLL cells.
23824909 Functional studies demonstrated that BAG3 interacts with the proteasome and modulates its activity, sustaining cell survival and underlying resistance to therapy through the down-modulation of apoptosis.
23582692 Missense mutations in antiapoptotic bag3 protein are found in patients with tako-tsubo cardiomyopathy.
23575457 Noncanonical autophagy mediated by BAG3 suppresses responsiveness of HepG2 cells to proteasome inhibitors
23553442 aberrant Bag-3 expression might be involved in colorectal adenoma-adenocarcinoma sequence and subsequent progression
23434281 Autophagosome formation during chaperone-assisted selective autophagy depends on an interaction of BAG3 with synaptopodin-2.
23434281 BAG3 balances autophagic degradation and YAP/TAZ-mediated transcription of filamin in mechanically strained cells and tissues. BAG3 uses its WW domain to associate with SYNPO2 during autophagosome formation or to bind the YAP/TAZ-inhibitors LATS1/2 and AMOTL1/2 during transcription regulation. This dual function is essential for tissue maintenance and for cell adhesion, migration and proliferation in mammals.
23395971 Hyperthermia sensitivity in human oral squamous cell carcinoma cells is enhanced upon silencing of BAG3 and inhibition of the JNK pathway.
23341456 Studies indicate BAG3-mediated Mcl-1 stabilization as a potential target for cancer drug discovery.
23271418 we identified Caspase 3, BAG1 and BAG3 as key targets of ERalpha in neuronal cells that may play a role in ERalpha-mediated neuroprotection.
23108398 BAG3 is a novel substrate of PKCdelta, and PKCdelta-mediated phosphorylation of BAG3 is implicated in EMT and invasiveness of thyroid cancer cells.
22984599 Data suggest that by investigating the interplay between large T-antigen (T-Ag) and Bag3 may provid better understanding on the development of JCV-associated diseases.
22944597 BAG3 expression level might be a potential marker for prediction of patient outcome.
22734908 This report confirms the association of giant axonal neuropathy with BAG3-associated myofibrillar myopathy
22310281 BAG3 is expressed in endothelial cells.
22302993 findings show that during heat shock recovery NF-kappaB activates selective removal of misfolded or aggregated proteins by controlling expression of BAG3 and HSPB8 and by modulating the level of the BAG3-HspB8 complex
22072743 BAG3 protein sustains anaplastic thyroid tumor growth in vitro and in vivo. The underlying molecular mechanism appears to rely on BAG3 binding to BRAF, thus protecting it from proteasome-dependent degradation.
22020323 the data support that BAG3 is induced by LPS via JNK and NF-kappaB-dependent signals, and involved in monocytic cell-extracellular matrix interaction, suggesting that BAG3 may have a role in the host response to LPS stimulation
21971866 non-small cell lung cancer cells were protected from apoptosis through increasing Bag3 expression and consequently promoted the expression of Bcl-XL and Bcl-2.
21898660 We report here two heterozygous missense mutations of BAG3 found in familial DCM, which cause abnormal Z-disc assembly and increase the sensitivity to apoptosis in the cardiomyocytes.
21850027 BAG3 is expressed in a proportion of melanoma and in the majority of metastases, so it may be involed in tumor development.
21767525 The complexes formed by Bag3 and HspB8 might have variable stoichiometry and can participate in different processes including clearing of the cell from improperly folded proteins.
21696420 we observed upregulation of HSPB8 and BAG3 selectively in astrocytes located within the degenerated areas of patients with protein aggregation diseases
21683594 This study identified no pathogenic mutations in BAG3, MATR3, PTRF or TCAP in Australian muscular dystrophy.
21561597 BAG3, although negative in normal brain tissues, was highly expressed in astrocytic tumors and increasingly expressed in more aggressive types of cancer; it was particularly high in glioblastomas.
21472004 Multifaceted interactions underlie BAG3 ability to modulate apoptosis, development, cytoskeleton organization and autophagy. [Review]
21459883 The results show that rare mutations in BAG3 contribute to monogenic forms of the disease, while common variant(s) in the same gene are implicated in sporadic DCM
21451574 BAG3 promotes the emergence of castration resistant prostate cancer by modulating IKKalpha nuclear translocation.
21423662 These findings indicate a novel function for BAG3 in inhibiting protein aggregation caused by the genetic mutation of CRYAB responsible for human myofibrillar myopathy.
21361913 the first Chinese case of Bag3opathy so far reported.
21353195 New comprehensive genomic approaches have identified rare variants in BAG3 as causative of dilated cardiomyopathy.
21316839 The incidence of BAG3 positivity was significantly higher at advanced clinical stages of ovarian cancer than at early stages. It is suggected BAG3 binds to MMP2 to positively regulate the process of cell invasion.
21302292 BAG3 was identified as a marker of electromagnetic field-induced stress. These results suggest that BAG3 induction by an electromagnetic field may contribute to melanoma cell survival and/or resistance to therapy.
21252941 aggresome-targeting by BAG3 is distinct from previously described mechanisms, as it does not depend on substrate ubiquitination
21233200 BAG3 expression in glioblastoma cells promotes accumulation of ubiquitinated clients in an Hsp70-dependent manner.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20800573 BAG3 overexpression increases cell adhesion in Cos7 cells, but not in PDZGEF2 gene knockdown cells indicating that PDZGEF2 is a critical partner for BAG3 in regulating cell adhesion
20723284 bag3 expression in chronic lymphocytic leukemia patients is markedly higher than that in normal controls, while high bag3 level in CML patients is probably related with drug resistance, but is not related with clinically established prognostic factors.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20607728 interaction between virus penton base protein and cellular co-chaperone BAG3 positively influences virus life cycle
20605452 These observations suggest that the BAG3 variant of myofibrillar myopathy may result from a spontaneous mutation at an early point of embryonic development and that transmission from a mosaic parent may occur more than once.
20535599 BAG3 intra-cytoplasmic delocalisation is a specific feature of cancer versus non-neoplastic prostate and a candidate new marker for prediction of prostate cancer invasiveness and behaviour.
20368414 BAG3 alters the interaction between HSP70 and IKKgamma, increasing availability of IKKgamma and protecting it from proteasome-dependent degradation; this, in turn, results in increased NF-kappaB activity and survival
20232307 BAG3 is cleaved during apoptosis of pancreatic cancer cells, disrupting its anti-apoptotic properties.
20018251 identification of BAG3 binding partner (cytosolic chaperonin CCT); BAG3/CTT complex binds to BAG3 promoter & exhibits biological function (i.e., influences correct folding of monomeric actin); study of BAG3 domain participation in binding to CCT
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850283 Observational study and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19845507 Data show that the interaction between HspB6 and Bag3 requires the same regions that are involved in the HspB8-Bag3 association.
19777443 BAG3 gene expression is controlled by its own product.
19352495 Loss of BAG3 under STS injury required sequential caspase cleavage followed by polyubiquitination and proteasomal degradation
19282432 This study showed that BAG3 protein is downregulated upon JC virus (JCV) infection and that this effect is mediated by JCV T-antigen via repression of the BAG3 promoter.
19212330 in a B-cell lymphoma cell line, physical interaction was observed between BTK and BAG3, possibly upon modifications induced by stress
19111544 These results indicate that knocking down BAG3 gene is a promising new approach to enhance the therapeutic potency of Bortezomib in leukemia.
19088197 a requirement for BAG3 to augment virus gene expression and demonstrate that the co-chaperone acts independently of promyelocytic leukemia to increase herpes simplex virus replication.
19085932 This study conclude mutation in Bag3 defines a novel severe autosomal dominant childhood muscular dystrophy.
18821563 Downmodulation of BAG3 protein levels allows caspase-3 activation by HIV-1 infection in human primary microglial cells.
18469860 Activation of BAG3 by Egr-1 in response to FGF-2 in neuroblastoma.
18286539 Two of the three putative heat shock-responsive elements (HSEs) in bag3 promoter interact with the heat shock factor (HSF) 1 in vitro and in vivo.
18094623 HspB8 and Bag3: a new chaperone complex targeting misfolded proteins to macroautophagy.
18006506 These results suggested that the HspB8-Bag3 complex might stimulate the degradation of Htt43Q by macroautophagy.
17996194 Taken together, our results suggest that BAG3 induction might represents as an unwanted molecular consequence of utilizing proteasome inhibitors to combat tumors.
17974966 High levels of BAG3 protein seen in some epithelial cancer cell lines may be relevant to mechanisms of tumor invasion and metastasis.
17507989 The metabolic pathway of BAG3 was studied.
17187345 These observations reveal a previously unrecognized cell response, that is, an increase in BAG3, elicited by HIV-1 infection, and may provide a new avenue for the suppression of HIV-1 gene expression.
17164298 BAG3 downmodulates the apoptotic response to TRAIL in human neoplastic thyroid cells.
16859681 Results indicate that CAIR-1 may negatively regulate adhesion, focal adhesion assembly, signaling, and migration via its PXXP domain.
16391524 These results suggest that the Bis induced growth inhibition of HL-60 cells promotes G0/G1 phase arrest via up-regulation of p27, which seems to be a prerequisite for differentiation.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12750378 findings suggest that heat shock protein-70 is a chaperone driving a multiprotein degradation complex and that the inhibitory co-chaperone CAIR-1 protein functions distal to client ubiquitination
12706811 heavy metals and temperature regulate BAG3 gene expression.
12700638 BAG3 protein has a role in apoptosis in B-chronic lymphocytic leukaemia cells

AA Sequence

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPKETPSSANGPS      1 - 70
REGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQRFRTEAAAAAPQRSQSPLRG     71 - 140
MPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCSSSSSSASLPSSGRSSLGSHQLPRGYISIPV    141 - 210
IHEQNVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSP    211 - 280
ARSSTPLHSPSPIRVHTVVDRPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKP    281 - 350
VSQKPPPPSEKVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP    351 - 420
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQARRDGVRKVQTI    421 - 490
LEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAGNAEDPHTETQQPEATAAATS    491 - 560
NPSSMTDTPGNPAAP                                                           561 - 575
//

Text Mined References (152)

PMID Year Title
26707573 2016 Autophagy-associated proteins BAG3 and p62 in testicular cancer.
26655271 2016 BAG3-mediated miRNA let-7g and let-7i inhibit proliferation and enhance apoptosis of human esophageal carcinoma cells by targeting the drug transporter ABCC10.
26621836 2016 BAG3 elevation inhibits cell proliferation via direct interaction with G6PD in hepatocellular carcinomas.
26545904 2015 BAG3-related myopathy, polyneuropathy and cardiomyopathy with long QT syndrome.
26541455 2015 MiR-143 enhances the antitumor activity of shikonin by targeting BAG3 expression in human glioblastoma stem cells.
26522614 2015 BAG3 promotes pancreatic ductal adenocarcinoma growth by activating stromal macrophages.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26496431 2015 A Role for the Chaperone Complex BAG3-HSPB8 in Actin Dynamics, Spindle Orientation and Proper Chromosome Segregation during Mitosis.
26337083 2015 Age-related obesity and type 2 diabetes dysregulate neuronal associated genes and proteins in humans.
26159920 2015 BAG3 affects the nucleocytoplasmic shuttling of HSF1 upon heat stress.
26158518 2015 Estrogen receptor ? regulates non-canonical autophagy that provides stress resistance to neuroblastoma and breast cancer cells and involves BAG3 function.
26100943 2016 Knockdown of BAG3 sensitizes bladder cancer cells to treatment with the BH3 mimetic ABT-737.
25968616 2015 Bis Expression in Patients with Surgically Resected Lung Cancer and its Clinical Significance.
25889438 2015 Involvement of BAG3 and HSPB7 loci in various etiologies of systolic heart failure: Results of a European collaboration assembling more than 2000 patients.
25766331 2015 NIK is required for NF-?B-mediated induction of BAG3 upon inhibition of constitutive protein degradation pathways.
25766323 2015 BAG3 regulates formation of the SNARE complex and insulin secretion.
25753466 2015 Analysis of BAG3 plasma concentrations in patients with acutely decompensated heart failure.
25738313 2015 BAG3 increases the invasiveness of uterine corpus carcinoma cells by suppressing miR-29b and enhancing MMP2 expression.
25564440 2015 Validation of the Hsp70-Bag3 protein-protein interaction as a potential therapeutic target in cancer.
25483098 2014 HIV-1 Tat protein induces glial cell autophagy through enhancement of BAG3 protein levels.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25448463 2014 Nonsense mutations in BAG3 are associated with early-onset dilated cardiomyopathy in French Canadians.
25416956 2014 A proteome-scale map of the human interactome network.
25412315 2014 BIS targeting induces cellular senescence through the regulation of 14-3-3 zeta/STAT3/SKP2/p27 in glioblastoma cells.
25361773 2015 Implication of Bcl-2-associated athanogene 3 in fibroblast growth factor-2-mediated epithelial-mesenchymal transition in renal epithelial cells.
25347739 2015 Hsp70 in cancer: back to the future.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
25273835 2014 Zebrafish models of BAG3 myofibrillar myopathy suggest a toxic gain of function leading to BAG3 insufficiency.
25208129 2014 Unusual multisystemic involvement and a novel BAG3 mutation revealed by NGS screening in a large cohort of myofibrillar myopathies.
25204229 2015 WW domain of BAG3 is required for the induction of autophagy in glioma cells.
25175321 2014 BAG3 down-modulation sensitizes HPV18(+) HeLa cells to PEITC-induced apoptosis and restores p53.
25149536 2014 The anti-apoptotic BAG3 protein is expressed in lung carcinomas and regulates small cell lung carcinoma (SCLC) tumor growth.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25046115 2014 BAG3 induces the sequestration of proteasomal clients into cytoplasmic puncta: implications for a proteasome-to-autophagy switch.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25008357 2014 The BAG3 gene variants in Polish patients with dilated cardiomyopathy: four novel mutations and a genotype-phenotype correlation.
24997994 2015 Proteomic analysis reveals a role for Bcl2-associated athanogene 3 and major vault protein in resistance to apoptosis in senescent cells by regulating ERK1/2 activation.
24994713 2014 Hsp70-Bag3 interactions regulate cancer-related signaling networks.
24895585 2014 BAG3 and HIF-1 ? coexpression detected by immunohistochemistry correlated with prognosis in hepatocellular carcinoma after liver transplantation.
24722298 2014 BAG3 protein expression in melanoma metastatic lymph nodes correlates with patients' survival.
24623017 2014 Decreased levels of BAG3 in a family with a rare variant and in idiopathic dilated cardiomyopathy.
24577090 2014 Knockdown of BAG3 induces epithelial-mesenchymal transition in thyroid cancer cells through ZEB1 activation.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
24492285 2014 Correlation of BAG-3 and heat shock protein 70 with CD30 expression in T-cell lymphomas.
24365746 2014 BAG3 regulates epithelial-mesenchymal transition and angiogenesis in human hepatocellular carcinoma.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24286317 2014 Down-modulation of Bis reduces the invasive ability of glioma cells induced by TPA, through NF-?B mediated activation of MMP-9.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140207 2013 BAG3 is upregulated by c-Jun and stabilizes JunD.
24080088 2013 BAG3 sensitizes cancer cells exposed to DNA damaging agents via direct interaction with GRP78.
23978946 2014 Overexpressed BAG3 is a potential therapeutic target in chronic lymphocytic leukemia.
23876161 2013 BAG3 protects bovine papillomavirus type 1-transformed equine fibroblasts against pro-death signals.
23824909 2013 Bcl2-associated athanogene 3 interactome analysis reveals a new role in modulating proteasome activity.
23582692 2013 Polymorphisms of the antiapoptotic protein bag3 may play a role in the pathogenesis of tako-tsubo cardiomyopathy.
23575457 2013 BAG3-dependent noncanonical autophagy induced by proteasome inhibition in HepG2 cells.
23553442 2013 Bag-3 expression is involved in pathogenesis and progression of colorectal carcinomas.
23434281 2013 Cellular mechanotransduction relies on tension-induced and chaperone-assisted autophagy.
23395971 2013 The combination of silencing BAG3 and inhibition of the JNK pathway enhances hyperthermia sensitivity in human oral squamous cell carcinoma cells.
23341456 2013 The stress protein BAG3 stabilizes Mcl-1 protein and promotes survival of cancer cells and resistance to antagonist ABT-737.
23271418 2013 Differential regulation of apoptosis-associated genes by estrogen receptor alpha in human neuroblastoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23108398 2013 PKC?-mediated phosphorylation of BAG3 at Ser187 site induces epithelial-mesenchymal transition and enhances invasiveness in thyroid cancer FRO cells.
22984599 2012 Bag3-induced autophagy is associated with degradation of JCV oncoprotein, T-Ag.
22944597 2012 Expression of the antiapoptotic protein BAG3 is a feature of pancreatic adenocarcinoma and its overexpression is associated with poorer survival.
22734908 2012 BAG3 mutations: another cause of giant axonal neuropathy.
22366786 2012 Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy.
22310281 2012 BAG3 controls angiogenesis through regulation of ERK phosphorylation.
22302993 2012 NF-?B regulates protein quality control after heat stress through modulation of the BAG3-HspB8 complex.
22072743 2012 BAG3 down-modulation reduces anaplastic thyroid tumor growth by enhancing proteasome-mediated degradation of BRAF protein.
22020323 2012 Involvement of JNK and NF-?B pathways in lipopolysaccharide (LPS)-induced BAG3 expression in human monocytic cells.
21971866 2012 Bag3 promotes resistance to apoptosis through Bcl-2 family members in non-small cell lung cancer.
21898660 2011 Dilated cardiomyopathy-associated BAG3 mutations impair Z-disc assembly and enhance sensitivity to apoptosis in cardiomyocytes.
21850027 2012 Expression of the anti-apoptotic protein BAG3 in human melanomas.
21767525 2011 Biochemical characterization of small heat shock protein HspB8 (Hsp22)-Bag3 interaction.
21696420 2012 The HSPB8-BAG3 chaperone complex is upregulated in astrocytes in the human brain affected by protein aggregation diseases.
21683594 2011 A study of FHL1, BAG3, MATR3, PTRF and TCAP in Australian muscular dystrophy patients.
21561597 2011 BAG3 protein is overexpressed in human glioblastoma and is a potential target for therapy.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21472004 2011 BAG3: a multifaceted protein that regulates major cell pathways.
21459883 2011 A genome-wide association study identifies two loci associated with heart failure due to dilated cardiomyopathy.
21451574 2011 BAG3 is required for IKK? nuclear translocation and emergence of castration resistant prostate cancer.
21423662 2011 BAG3 directly interacts with mutated alphaB-crystallin to suppress its aggregation and toxicity.
21361913 2012 BAG3-related myofibrillar myopathy in a Chinese family.
21353195 2011 Genome-wide studies of copy number variation and exome sequencing identify rare variants in BAG3 as a cause of dilated cardiomyopathy.
21316839 2011 BAG3 (BCL2-associated athanogene 3) interacts with MMP-2 to positively regulate invasion by ovarian carcinoma cells.
21302292 2011 Exposure to 50?Hz electromagnetic field raises the levels of the anti-apoptotic protein BAG3 in melanoma cells.
21269460 2011 Initial characterization of the human central proteome.
21252941 2011 BAG3 mediates chaperone-based aggresome-targeting and selective autophagy of misfolded proteins.
21233200 2011 BAG3 expression in glioblastoma cells promotes accumulation of ubiquitinated clients in an Hsp70-dependent manner.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20800573 2010 BAG3 directly associates with guanine nucleotide exchange factor of Rap1, PDZGEF2, and regulates cell adhesion.
20723284 2010 [Bag3 gene expression in chronic lymphocytic leukemia and its association with patients' prognosis].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20607728 2010 Co-chaperone BAG3 and adenovirus penton base protein partnership.
20605452 2010 Inheritance patterns and phenotypic features of myofibrillar myopathy associated with a BAG3 mutation.
20535599 2010 BAG3 protein delocalisation in prostate carcinoma.
20368414 2010 IKK{gamma} protein is a target of BAG3 regulatory activity in human tumor growth.
20232307 2010 Characterization of BAG3 cleavage during apoptosis of pancreatic cancer cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20060297 2010 Chaperone-assisted selective autophagy is essential for muscle maintenance.
20018251 2010 The co-chaperone BAG3 interacts with the cytosolic chaperonin CCT: new hints for actin folding.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850283 2010 Identification of novel candidate genes for treatment response to risperidone and susceptibility for schizophrenia: integrated analysis among pharmacogenomics, mouse expression, and genetic case-control association approaches.
19845507 2009 Identification of the key structural motifs involved in HspB8/HspB6-Bag3 interaction.
19777443 2009 Autoregulation of co-chaperone BAG3 gene transcription.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19352495 2009 The anti-apoptotic activity of BAG3 is restricted by caspases and the proteasome.
19282432 2009 Evidence for modulation of BAG3 by polyomavirus JC early protein.
19229298 2009 Protein quality control during aging involves recruitment of the macroautophagy pathway by BAG3.
19212330 2009 Identification of a Btk-BAG3 complex induced by oxidative stress.
19111544 2009 BAG3 gene silencing sensitizes leukemic cells to Bortezomib-induced apoptosis.
19088197 2008 The co-chaperone BAG3 regulates Herpes Simplex Virus replication.
19085932 2009 Mutation in BAG3 causes severe dominant childhood muscular dystrophy.
18821563 2009 BAG3 protein regulates caspase-3 activation in HIV-1-infected human primary microglial cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18469860 2008 Activation of BAG3 by Egr-1 in response to FGF-2 in neuroblastoma cells.
18286539 2008 Bag3 gene expression is regulated by heat shock factor 1.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18094623 2008 HspB8 and Bag3: a new chaperone complex targeting misfolded proteins to macroautophagy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006506 2008 HspB8 chaperone activity toward poly(Q)-containing proteins depends on its association with Bag3, a stimulator of macroautophagy.
17996194 2008 Transcriptional upregulation of BAG3 upon proteasome inhibition.
17974966 2007 BAG3 regulates motility and adhesion of epithelial cancer cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17507989 2007 Achaete-scute homolog-1 linked to remodeling and preneoplasia of pulmonary epithelium.
17187345 2007 Evidence for BAG3 modulation of HIV-1 gene transcription.
17164298 2007 The antiapoptotic protein BAG3 is expressed in thyroid carcinomas and modulates apoptosis mediated by tumor necrosis factor-related apoptosis-inducing ligand.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16859681 2006 CAIR-1/BAG-3 modulates cell adhesion and migration by downregulating activity of focal adhesion proteins.
16391524 2005 Bis induces growth inhibition and differentiation of HL-60 cells via up-regulation of p27.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12750378 2003 CAIR-1/BAG-3 abrogates heat shock protein-70 chaperone complex-mediated protein degradation: accumulation of poly-ubiquitinated Hsp90 client proteins.
12706811 2003 Regulation by heavy metals and temperature of the human BAG-3 gene, a modulator of Hsp70 activity.
12700638 2003 BAG3 protein controls B-chronic lymphocytic leukaemia cell apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11513873 2001 The anti-apoptotic protein BAG-3 is overexpressed in pancreatic cancer and induced by heat stress in pancreatic cancer cell lines.
10980614 2000 CAIR-1/BAG-3 forms an EGF-regulated ternary complex with phospholipase C-gamma and Hsp70/Hsc70.
10597216 1999 Bis, a Bcl-2-binding protein that synergizes with Bcl-2 in preventing cell death.
9873016 1999 An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.