Property Summary

NCBI Gene PubMed Count 138
PubMed Score 335.07
PubTator Score 231.96

Knowledge Summary

Patent

No data available

Expression

PDB (26)

Gene RIF (96)

AA Sequence

MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPTRGAAAGARRP      1 - 70
RMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMA     71 - 140
AAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQ    141 - 210
DGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA    211 - 280
TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE         281 - 345
//

Text Mined References (141)

PMID Year Title