Property Summary

NCBI Gene PubMed Count 134
PubMed Score 329.06
PubTator Score 231.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

Synonym

Accession Q99933 O75315 Q14414 Q53H32 Q5VZE8 Q5VZE9 Q5VZF0 Q96TG2 Q9Y2V4 BAG-1
Symbols HAP
BAG-1
RAP46

Gene

PDB

1HX1   1WXV   3FZF   3FZH   3FZK   3FZL   3FZM   3LDQ   3M3Z  

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (92)

PMID Text
26178413 Bag-1 indirectly affects cell survival through c-Myc activated signalling that causes elevation of ornithine decarboxylase levels, leading to an increase of the polyamine content.
26124006 the combined effects of BAG-1 and XPD polymorphisms on chemotherapy sensitivity and survival in patients with advanced non-small-cell lung cancer, which might be the important predictive markers for platinum-based chemotherapy efficacy.
26087710 Taken together, these data indicate that Bag-1 up-regulation is required to maintain apoptosis resistance in human cytomegalovirus-infected cells.
25962180 Overexpression of miR-138 inhibited cell proliferation by directly suppressing the expression of Bag-1.
25069471 BAG-1 expression was high in esophageal carcinoma tissues compared to normal esophagus. After Eca109 cells were transfected with BAG-1-siRNA, the proliferation and invasive capabilities of the cells were decreased while the apoptosis rate was enhanced.
24969872 Forced Bag-1L expression prevented Cisplatin-induced apoptosis.
24876225 BAG-1M mediates Hsp70 inhibition downstream of NF-kappaB.
24830325 The expression of BAG-1 was upregulated in chronic non-eosinophilic rhinosinusitis.
24557447 distinct isoforms of BAG-1 had different anti-apoptotic ability in breast cancer cells treated with the 4-OH TAM.
24523409 GARRPR in Bag-1L as a novel BF-3 regulatory sequence important for fine-tuning the activity of the AR
More...

AA Sequence

MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPTRGAAAGARRP      1 - 70
RMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMA     71 - 140
AAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQ    141 - 210
DGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA    211 - 280
TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE         281 - 345
//

Text Mined References (137)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26178413 2015 Bag-1 promotes cell survival through c-Myc-mediated ODC upregulation that is not preferred under apoptotic stimuli in MCF-7 cells.
26124006 2015 Association between polymorphisms of BAG-1 and XPD and chemotherapy sensitivity in advanced non-small-cell lung cancer patients treated with vinorelbine combined cisplatin regimen.
26087710 2015 Human cytomegalovirus inhibits apoptosis involving upregulation of the antiapoptotic protein Bag-1.
25962180 2015 MiR-138 Suppresses Cell Proliferation by Targeting Bag-1 in Gallbladder Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25069471 2014 Expression of BAG-1 is closely related to cell differentiation and TNM stage in esophageal cancer and its downregulation inhibits the proliferation and invasion of human esophageal carcinoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24969872 2014 Bag-1L is a stress-withstand molecule prevents the downregulation of Mcl-1 and c-Raf under control of heat shock proteins in cisplatin treated HeLa cervix cancer cells.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
More...