Property Summary

NCBI Gene PubMed Count 67
PubMed Score 89.84
PubTator Score 67.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer -2.500 1.7e-25
Common variable immunodeficiency -1.611 2.3e-03
group 3 medulloblastoma 2.000 3.0e-03
Hydrolethalus syndrome -2.031 8.1e-03
intraductal papillary-mucinous carcinoma... -1.300 5.2e-03
intraductal papillary-mucinous neoplasm ... -1.400 2.3e-02
invasive ductal carcinoma -1.071 1.3e-02
lung cancer 1.500 4.1e-03
nasopharyngeal carcinoma -1.100 1.3e-02
osteosarcoma -1.902 3.6e-02
ovarian cancer -1.900 8.6e-12
primary Sjogren syndrome 1.400 1.7e-03
primitive neuroectodermal tumor 1.400 3.9e-02
psoriasis -1.300 9.9e-13
tuberculosis -1.100 3.3e-03
ulcerative colitis 1.100 4.2e-02
Waldenstrons macroglobulinemia -2.463 2.8e-03

Gene RIF (46)

AA Sequence

MSVDEKPDSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQT      1 - 70
KNDLVVSLPEEVTARGFGPLLQFAYTAKLLLSRENIREVIRCAEFLRMHNLEDSCFSFLQTQLLNSEDGL     71 - 140
FVCRKDAACQRPHEDCENSAGEEEDEEEETMDSETAKMACPRDQMLPEPISFEAAAIPVAEKEEALLPEP    141 - 210
DVPTDTKESSEKDALTQYPRYKKYQLACTKNVYNASSHSTSGFASTFREDNSSNSLKPGLARGQIKSEPP    211 - 280
SEENEEESITLCLSGDEPDAKDRAGDVEMDRKQPSPAPTPTAPAGAACLERSRSVASPSCLRSLFSITKS    281 - 350
VELSGLPSTSQQHFARSPACPFDKGITQGDLKTDYTPFTGNYGQPHVGQKEVSNFTMGSPLRGPGLEALC    351 - 420
KQEGELDRRSVIFSSSACDQVSTSVHSYSGVSSLDKDLSEPVPKGLWVGAGQSLPSSQAYSHGGLMADHL    421 - 490
PGRMRPNTSCPVPIKVCPRSPPLETRTRTSSSCSSYSYAEDGSGGSPCSLPLCEFSSSPCSQGARFLATE    491 - 560
HQEPGLMGDGMYNQVRPQIKCEQSYGTNSSDESGSFSEADSESCPVQDRGQEVKLPFPVDQITDLPRNDF    561 - 630
QMMIKMHKLTSEQLEFIHDVRRRSKNRIAAQRCRKRKLDCIQNLECEIRKLVCEKEKLLSERNQLKACMG    631 - 700
ELLDNFSCLSQEVCRDIQSPEQIQALHRYCPVLRPMDLPTASSINPAPLGAEQNIAASQCAVGENVPCCL    701 - 770
EPGAAPPGPPWAPSNTSENCTSGRRLEGTDPGTFSERGPPLEPRSQTVTVDFCQEMTDKCTTDEQPRKDY    771 - 840
T//

Text Mined References (69)

PMID Year Title