Property Summary

NCBI Gene PubMed Count 65
PubMed Score 7.38
PubTator Score 86.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma 1.560 6.7e-03
glioblastoma 1.800 5.7e-04
group 4 medulloblastoma 1.400 2.8e-04
primitive neuroectodermal tumor 1.400 3.5e-05
lung cancer -1.200 3.6e-04
sarcoidosis 1.100 3.7e-02
diabetes mellitus -1.100 8.3e-03
pediatric high grade glioma 1.400 3.6e-06
pilocytic astrocytoma 1.600 3.1e-07
posterior fossa group A ependymoma 1.100 2.3e-05
aldosterone-producing adenoma -1.152 1.7e-02
lung carcinoma -1.300 3.7e-17
Breast cancer -1.100 2.3e-07
ovarian cancer -2.000 1.6e-07
Gaucher disease type 1 -1.700 1.3e-02
dermatomyositis 1.100 8.1e-03

Gene RIF (41)

PMID Text
26445536 heme oxygenase-1 expression is induced by gold nanoparticles through Nrf2 activation and Bach1 export in human vascular endothelial cells
26422990 Cyanidin-3-O-glucoside protects HUVECs from palmitic acid-induced injuryby modulating the balance of Nrf2 versus Bach1 inside the nucleus so influencing upregulation of electrophile responsive element mediated gene expression.
26244607 sensitizer-induced up-regulation of both the endogenous HMOX1 and the luciferase constructs under the control of the HMOX1-ARE or the full HMOX1 promoter appear to be under the control of both Nrf2 and Bach1.
26123998 Bach1 suppresses angiogenesis after ischemic injury and impairs Wnt/beta-catenin signaling by disrupting the interaction between beta-catenin and TCF4 and by recruiting histone deacetylase 1 to the promoter of TCF4-targeted genes.
25391381 This study demonstrated that Bach1 overexpression in Down syndrome correlates with the alteration of the HO-1/BVR-a system.
24752012 Higher HMOX1 expression correlated with higher expression of Bach-1 (Spearman's rho = 0.586, p = 0.000001) and miR-122 (Spearman's rho = 0.270, p = 0.014059).
24613679 The Bach1-dependent repression of the HO-1 expression is under the control of the Hx-dependent uptake of extracellular heme
24395801 BACH1 acts in a double-negative (overall positive) feedback loop to inhibit RKIP transcription in breast cancer cells
24366869 CXCR3-B mediates a growth-inhibitory signal in breast cancer cells through the modulations of nuclear translocation of Bach-1 and Nrf2 and down-regulation of HO-1.
24035498 Identify a role for SCF(FBXL17) in controlling the threshold for NRF2-dependent gene activation via BACH1 repressor turnover.
23738048 The arsenic-induced Nrf2 pathway activation in hepatocytes suggested that the translocation of Bach1 was associated with the regulation of Nrf2 pathway by arsenic.
23737527 Data indicate that transcription factors MafK and Bach1 regulate expression of heme oxygenase-1 (HO-1).
23455180 In colorectal cancer, Nrf2 expression is closely correlated with Keap1 in the tumor and with Bach1 in the normal tissue.
22698995 let-7 miRNA directly acts on the 3'-UTR of Bach1 and negatively regulates expression of this protein, and thereby up-regulates HMOX1 gene expression.
22307849 miR-155 may function as an oncogene by targeting BACH1
22289179 Bach1 depletion resulted in disordered mitotic chromosome alignment, which was rescued by Bach1 mutants lacking the BTB or DNA binding domains, suggesting its transcription-independent mechanism.
22032289 Since BRCA1 and BACH1 mutations targeting the BRCA1-BACH1 interaction have been associated with breast cancer susceptibility, the results of the present study thus provide evidence for a novel role of BACH1 in tumour suppression.
21812759 We conclude that BACH1 is a bona fide Nrf2 target gene and that induction of BACH1 by Nrf2 may serve as a feedback-inhibitory mechanism for antioxidant-response-element-mediated gene regulation.
21555518 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
21555518 The BACH1 target genes in HEK 293 cells are involved in heme degradation, redox regulation, cell cycle/apoptosis pathways and subcellular transport processes.
20345481 Bach1 plays a critical role in regulating HO-1 gene expression in AML cells and its expression suppresses their survival by downregulating HO-1 expression.
20127796 miR-196 directly acts on the 3'-UTR of Bach1 messenger RNA and translationally represses the expression of this protein.
19874887 prevents radiation-induced upregulation of heme oxygenase 1 gene expression in keratinocytes
19822148 ERK(1/2) and JNK are involved in cigarette smoking-induced biphasic HO-1 expression by a specific regulation of Nrf2/Keap1-Bach1.
19618874 regulates oxidative stress response in cellular senescence. (review)
19591297 Bach1 inhibits expression of oxidative stress responsive genes by competing with Nrf2, the key activator of oxidative stress response. Bach1 inhibits p53-dependent cellular senescence induced by oxidative stress
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18550526 Loss of BACH1 function in human keratinocytes results almost exclusively in HMOX1 induction
17881434 BACH-1 protein levels are low in cells expressing either the human miR-155 or miR-K12-11 of Kaposi's sarcoma-associated herpesvirus.
17065227 The effect of Bach1 and Nrf2 on heme oxygenase 1 expression via cobalt protoporphyrin in human liver cells is reported.
16771696 Data show that beta-carotene, combined with cigarette smoke condensate (TAR), regulates heme oxygenase-1 (HO-1) via its transcriptional factor Bach1 and modulates cell growth.
16724942 Reviewer presents the Bach1-heme oxygenase(HO)-1 system as an important defense mechanism against oxidative stress--a mechanism in which Bach1 is a critical regulator of HO-1.
16530877 key role of down-regulation of Bach1 and up-regulation of heme oxygenase 1 in diminishing cytotoxic effects of hepatitis C virus proteins in human hepatocytes.
15613547 BACH1 acts as a transcriptional repressor in the regulation of Maf recognition-element-dependent genes in megakaryocytes.
15465821 Bach-1 has a specific and selective ability to repress expression of hepatic heme oxygenase-1
15464985 These results indicated that heme plays an important role in the induction of alpha-globin gene expression through disrupting the interaction of Bach1 and the NA site in HS-40 enhancer in erythroid cells.
15068251 BACH1 protein is significantly overexpressed in fetal Down syndrome cerebral cortex and may contribute to abnormal brain development or at least to defective transcription machinery in Down syndrome.
15068237 BACH1 plays a role in the development of Alzheimer's disease (AD)-like neuropathology in Down syndrome and in pathogenesis of AD per se.
14660636 Bach1 binding to the Maf recognition element in the microlocus control region is blocked by heme in the beta-globin regulation pathway
14504288 nuclear export of Bach1 constitutes an important regulatory mechanism to relieve the Bach1-mediated repression of genes such as heme oxygenase 1
12511571 Bach1 functions as a hypoxia-inducible repressor for the HO-1 gene, thereby contributing to fine-tuning of oxygen homeostasis in human cells

AA Sequence

MSLSENSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVEGQRFRAHRSVLAACSSYFHSRIVGQADGE      1 - 70
LNITLPEEVTVKGFEPLIQFAYTAKLILSKENVDEVCKCVEFLSVHNIEESCFQFLKFKFLDSTADQQEC     71 - 140
PRKKCFSSHCQKTDLKLSLLDQRDLETDEVEEFLENKNVQTPQCKLRRYQGNAKASPPLQDSASQTYESM    141 - 210
CLEKDAALALPSLCPKYRKFQKAFGTDRVRTGESSVKDIHASVQPNERSENECLGGVPECRDLQVMLKCD    211 - 280
ESKLAMEPEETKKDPASQCPTEKSEVTPFPHNSSIDPHGLYSLSLLHTYDQYGDLNFAGMQNTTVLTEKP    281 - 350
LSGTDVQEKTFGESQDLPLKSDLGTREDSSVASSDRSSVEREVAEHLAKGFWSDICSTDTPCQMQLSPAV    351 - 420
AKDGSEQISQKRSECPWLGIRISESPEPGQRTFTTLSSVNCPFISTLSTEGCSSNLEIGNDDYVSEPQQE    421 - 490
PCPYACVISLGDDSETDTEGDSESCSAREQECEVKLPFNAQRIISLSRNDFQSLLKMHKLTPEQLDCIHD    491 - 560
IRRRSKNRIAAQRCRKRKLDCIQNLESEIEKLQSEKESLLKERDHILSTLGETKQNLTGLCQKVCKEAAL    561 - 630
SQEQIQILAKYSAADCPLSFLISEKDKSTPDGELALPSIFSLSDRPPAVLPPCARGNSEPGYARGQESQQ    631 - 700
MSTATSEQAGPAEQCRQSGGISDFCQQMTDKCTTDE                                      701 - 736
//

Text Mined References (68)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26445536 2015 Gold nanoparticles induce heme oxygenase-1 expression through Nrf2 activation and Bach1 export in human vascular endothelial cells.
26422990 2015 Palmitate-induced endothelial dysfunction is attenuated by cyanidin-3-O-glucoside through modulation of Nrf2/Bach1 and NF-?B pathways.
26244607 2015 Dual regulation of skin sensitizer-induced HMOX1 expression by Bach1 and Nrf2: Comparison to regulation of the AKR1C2-ARE element in the KeratinoSens cell line.
26123998 2015 Bach1 Represses Wnt/?-Catenin Signaling and Angiogenesis.
25391381 2015 Bach1 overexpression in Down syndrome correlates with the alteration of the HO-1/BVR-a system: insights for transition to Alzheimer's disease.
24752012 2014 Hepatic HMOX1 expression positively correlates with Bach-1 and miR-122 in patients with HCV mono and HIV/HCV coinfection.
24613679 2014 Hemopexin-dependent heme uptake via endocytosis regulates the Bach1 transcription repressor and heme oxygenase gene activation.
24395801 2014 Network of mutually repressive metastasis regulators can promote cell heterogeneity and metastatic transitions.
24366869 2014 A novel CXCR3-B chemokine receptor-induced growth-inhibitory signal in cancer cells is mediated through the regulation of Bach-1 protein and Nrf2 protein nuclear translocation.
24035498 2013 Parallel SCF adaptor capture proteomics reveals a role for SCFFBXL17 in NRF2 activation via BACH1 repressor turnover.
23738048 2013 Activation of the Nrf2 pathway by inorganic arsenic in human hepatocytes and the role of transcriptional repressor Bach1.
23737527 2013 Transforming growth factor-? induces transcription factors MafK and Bach1 to suppress expression of the heme oxygenase-1 gene.
23455180 2013 Immunohistochemical study of the Nrf2 pathway in colorectal cancer: Nrf2 expression is closely correlated to Keap1 in the tumor and Bach1 in the normal tissue.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22875853 2012 Transcriptional network analysis identifies BACH1 as a master regulator of breast cancer bone metastasis.
22698995 The let-7 microRNA enhances heme oxygenase-1 by suppressing Bach1 and attenuates oxidant injury in human hepatocytes.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22307849 2012 microRNA-155 silencing inhibits proliferation and migration and induces apoptosis by upregulating BACH1 in renal cancer cells.
22289179 2012 Transcription-independent role of Bach1 in mitosis through a nuclear exporter Crm1-dependent mechanism.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
22032289 2012 BRCA1-mediated repression of mutagenic end-joining of DNA double-strand breaks requires complex formation with BACH1.
21812759 2011 Novel insights into the regulation of antioxidant-response-element-mediated gene expression by electrophiles: induction of the transcriptional repressor BACH1 by Nrf2.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20978114 2010 An MLH1 mutation links BACH1/FANCJ to colon cancer, signaling, and insight toward directed therapy.
20345481 2010 Expression of heme oxygenase-1 in human leukemic cells and its regulation by transcriptional repressor Bach1.
20127796 2010 MicroRNA-196 represses Bach1 protein and hepatitis C virus gene expression in human hepatoma cells expressing hepatitis C viral proteins.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19874887 2010 A role for Bach1 and HO-2 in suppression of basal and UVA-induced HO-1 expression in human keratinocytes.
19822148 2009 Prolonged cigarette smoke exposure decreases heme oxygenase-1 and alters Nrf2 and Bach1 expression in human macrophages: roles of the MAP kinases ERK(1/2) and JNK.
19618874 2009 [Transcriptional regulation of cellular senescence].
19591297 2009 [Regulation of cellular senescence by Bach1].
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550526 2008 BACH1 is a specific repressor of HMOX1 that is inactivated by arsenite.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17881434 2007 Kaposi's sarcoma-associated herpesvirus encodes an ortholog of miR-155.
17065227 2006 Role of Bach1 and Nrf2 in up-regulation of the heme oxygenase-1 gene by cobalt protoporphyrin.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16771696 beta-Carotene and cigarette smoke condensate regulate heme oxygenase-1 and its repressor factor Bach1: relationship with cell growth.
16724942 2006 New biotechnological methods to reduce oxidative stress in the cardiovascular system: focusing on the Bach1/heme oxygenase-1 pathway.
16530877 2006 HCV proteins increase expression of heme oxygenase-1 (HO-1) and decrease expression of Bach1 in human hepatoma cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
15734732 2005 Bach1 competes with Nrf2 leading to negative regulation of the antioxidant response element (ARE)-mediated NAD(P)H:quinone oxidoreductase 1 gene expression and induction in response to antioxidants.
15613547 2005 Transgenic expression of BACH1 transcription factor results in megakaryocytic impairment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465821 2004 Role of Bach-1 in regulation of heme oxygenase-1 in human liver cells: insights from studies with small interfering RNAS.
15464985 2004 Heme-dependent up-regulation of the alpha-globin gene expression by transcriptional repressor Bach1 in erythroid cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15175654 2004 Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.
15068251 2003 Overexpression of transcription factor BACH1 in fetal Down syndrome brain.
15068237 2003 Aberrant protein expression of transcription factors BACH1 and ERG, both encoded on chromosome 21, in brains of patients with Down syndrome and Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660636 2004 Heme positively regulates the expression of beta-globin at the locus control region via the transcriptional factor Bach1 in erythroid cells.
14504288 2003 Cadmium induces nuclear export of Bach1, a transcriptional repressor of heme oxygenase-1 gene.
12511571 2003 Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036298 2002 Annotation of human chromosome 21 for relevance to Down syndrome: gene structure and expression analysis.
11069897 2001 Transcription factor BACH1 is recruited to the nucleus by its novel alternative spliced isoform.
10830953 2000 The DNA sequence of human chromosome 21.
10669750 2000 A combinatorial code for gene expression generated by transcription factor Bach2 and MAZR (MAZ-related factor) through the BTB/POZ domain.
9544839 1998 Isolation of the human BACH1 transcription regulator gene, which maps to chromosome 21q22.1.
9479503 1998 Characterization of a human homolog (BACH1) of the mouse Bach1 gene encoding a BTB-basic leucine zipper transcription factor and its mapping to chromosome 21q22.1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8887638 1996 Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.