Property Summary

NCBI Gene PubMed Count 37
PubMed Score 45.86
PubTator Score 49.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
oligodendroglioma 1.400 3.2e-03
ependymoma -1.300 8.9e-03
sonic hedgehog group medulloblastoma -3.600 1.3e-09
atypical teratoid/rhabdoid tumor -4.600 1.2e-12
medulloblastoma, large-cell -3.600 2.0e-05
primitive neuroectodermal tumor -2.200 2.0e-02
lung cancer -1.200 6.6e-03
lung adenocarcinoma -1.300 1.3e-08
spina bifida 1.923 4.8e-02
Pick disease -1.200 7.5e-04
mucosa-associated lymphoid tissue lympho... -1.042 1.8e-02

Gene RIF (31)

PMID Text
26625814 BAALC and ERG genes are specific significant molecular markers in acute myeloid leukemia disease progression, response to treatment and survival.
26430723 combined determination of both miR-3151 and BAALC improved this prognostic stratification, with patients with low levels of both parameters showing a better outcome compared with those patients harboring increased levels of one or both markers
26050649 demonstrated that BAALC blocks ERK-mediated monocytic differentiation of acute myeloid leukemia cells by trapping Kruppel-like factor 4 (KLF4) in the cytoplasm and inhibiting its function in the nucleus
26012361 Evaluating WT1 and BAALC gene expression at diagnosis may improve standard risk stratification and possibly refine the therapeutic approach for Myelodysplastic Syndromes patients.
25428390 study indicates that overexpression of BAALC serves as an independent prognostic biomarker in acute myeloid leukemia
24855032 Thus low MDR1/low BAALC expression identifies a subgroup of intermediate cytogenetic risk AML patients with a remarkably good long-term outcome achieved by chemotherapy alone.
24736457 miR-3151 introns within BAALC have roles in driving leukemogenesis by deregulating the TP53 pathway
23865362 Investigated the prognostic impact of brain and acute leukemia, cytoplasmic (BAALC) expression in acute myeloid leukemia with normal karyotype.
23760853 BAALC overexpression retains its negative prognostic role across all cytogenetic risk groups in acute myeloid leukemia patients.
23672350 higher post-HSCT BAALC and WT1 expressions in patients with CBF-AML may be good markers of minimal residual disease for the prediction of survival and relapse after HSCT.
23647058 Higher BAALC expression and FLT3-ITD mutation, both individually and in combination, were associated with worse survival outcomes in CN-AML, and this was also applicable in NPM1-mutated CN-AML, known as a favorable-risk group.
23287429 data show that higher levels of VEGF-A(CSF) are closely related to CNS leukemia (CNSL), and VEGF-A(CSF) may be a better predictor than the other risk factors elucidating the pathogenesis and development of CNSL
22529287 high expression of miR-3151 is an independent prognosticator for poor outcome in cytogenetically normal-AML and affects different outcome end points than its host gene, BAALC
22493267 identify a heritable genomic feature predisposing to overexpression of an oncogene (BAALC), thereby possibly leading to enhanced AML leukemogenesis
22488406 A high MEBE (MN1,ERG, BAALC, EVI1) expression score is an unfavorable prognostic marker in Myelodysplastic syndrome and is associated with an increased risk for progression to Acute myeloid leukemia.
22197554 These findings indicate that BAALC gene is "paused" and that in leukemia cells its transcription can be activated or repressed by mechanisms acting on epigenetic marks.
21967978 Presence of FLT3-ITD and high BAALC expression are independent prognostic markers in childhood acute myeloid leukemia.
21835957 Low ERG and BAALC expression (E/B(low)) and NOTCH1/FBXW7 (N/F) mutations have been proposed as powerful prognostic markers in large cohorts of adult T-ALL.
20841507 High BAALC expression levels are associated with acute myeloid leukemia.
20535151 In contrast to BAALC, which likely represents only a surrogate marker of treatment failure in acute leukemia, IGFBP7 regulates the proliferation of leukemic cells and might be involved in chemotherapy resistance
20495894 1-5-6-8 BAALC isoform expression may be associated with an adverse prognosis in pediatric acute myeloid leukemia with normal karyotype.
20306678 CEBPA mutation status and BAALC expression are important prognostic factors in acute myeloid leukemia patients with normal cytogenetics.
20065290 High BAALC expression is associated with chemoresistance in adult B-precursor acute lymphoblastic leukemia.
19943049 BAALC is a relevant prognostic marker in intermediate-risk acute myeloid leukemia patients, with high versus low BAALC expressors showing lower complete remission rate after salvage therapy.
19555438 Overexpression of BAALC and ERG either separate or concomitant predict adverse clinical outcome and may define important risk factor in cytogenetically normal acute myeloid leukemia
18752846 Presence of both EVI1 and/or BAALC in chronic myeloid patients was found to modulate the disease pattern
18671757 Up-regulation of BAALC gene may be an important alteration in AML-M2 patients with t(8;21) translocation.
18378853 high BAALC expression is an independent adverse prognostic factor and is associated with a specific gene-expression profile
17646667 Low expression of both ERG and BAALC identifies T-ALL patients with a distinctly favorable long-term outcome.
15749074 High transcript levels occur in leukemic blasts from some patients with acute myeloid leukemia.
15604894 The BAALC gene, located on chromosome 8q22.3, encodes a protein with no homology to any known proteins or functional domains.

AA Sequence

MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSVLEAEKSKIKAPTDSVS      1 - 70
DEGLFSASKMAPLAVFSHGMLEDGLPSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGL     71 - 140
QTTEAKRDAKRMPAKEVTINVTDSIQQMDRSRRITKNCVN                                  141 - 180
//

Text Mined References (37)

PMID Year Title
26625814 2015 Relation of BAALC and ERG Gene Expression with Overall Survival in Acute Myeloid Leukemia Cases.
26430723 2015 The expression level of BAALC-associated microRNA miR-3151 is an independent prognostic factor in younger patients with cytogenetic intermediate-risk acute myeloid leukemia.
26050649 2015 BAALC potentiates oncogenic ERK pathway through interactions with MEKK1 and KLF4.
26012361 2015 Combined assessment of WT1 and BAALC gene expression at diagnosis may improve leukemia-free survival prediction in patients with myelodysplastic syndromes.
25428390 2015 Overexpression of BAALC: clinical significance in Chinese de novo acute myeloid leukemia.
24855032 2014 Low MDR1 and BAALC expression identifies a new subgroup of intermediate cytogenetic risk acute myeloid leukemia with a favorable outcome.
24736457 2014 Intronic miR-3151 within BAALC drives leukemogenesis by deregulating the TP53 pathway.
23865362 2013 Prognostic implication of BAALC gene expression in adult acute myeloid leukemia.
23760853 2013 BAALC overexpression retains its negative prognostic role across all cytogenetic risk groups in acute myeloid leukemia patients.
23672350 2013 BAALC and WT1 expressions from diagnosis to hematopoietic stem cell transplantation: consecutive monitoring in adult patients with core-binding-factor-positive AML.
23647058 2014 Implication of higher BAALC expression in combination with other gene mutations in adult cytogenetically normal acute myeloid leukemia.
23287429 2013 In acute promyelocytic leukemia (APL) low BAALC gene expression identifies a patient group with favorable overall survival and improved relapse free survival.
22529287 2012 miR-3151 interplays with its host gene BAALC and independently affects outcome of patients with cytogenetically normal acute myeloid leukemia.
22493267 2012 Heritable polymorphism predisposes to high BAALC expression in acute myeloid leukemia.
22488406 2012 Prognostic significance of combined MN1, ERG, BAALC, and EVI1 (MEBE) expression in patients with myelodysplastic syndromes.
22197554 2012 Histone post-translational modifications associated to BAALC expression in leukemic cells.
21967978 2011 Presence of FLT3-ITD and high BAALC expression are independent prognostic markers in childhood acute myeloid leukemia.
21835957 2011 Pediatric-inspired intensified therapy of adult T-ALL reveals the favorable outcome of NOTCH1/FBXW7 mutations, but not of low ERG/BAALC expression: a GRAALL study.
20841507 2010 BAALC and ERG expression levels are associated with outcome and distinct gene and microRNA expression profiles in older patients with de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
20535151 2010 BAALC-associated gene expression profiles define IGFBP7 as a novel molecular marker in acute leukemia.
20495894 2010 Prognostic significance of the BAALC isoform pattern and CEBPA mutations in pediatric acute myeloid leukemia with normal karyotype: a study by the Japanese Childhood AML Cooperative Study Group.
20306678 2008 Prognostic significance of CEBPA mutations and BAALC expression in acute myeloid leukemia Egyptian patients with normal karyotype.
20065290 2010 High BAALC expression predicts chemoresistance in adult B-precursor acute lymphoblastic leukemia.
19943049 2010 BAALC is an important predictor of refractoriness to chemotherapy and poor survival in intermediate-risk acute myeloid leukemia (AML).
19555438 2010 BAALC and ERG expression in acute myeloid leukemia with normal karyotype: impact on prognosis.
18752846 2009 EVI1, BAALC and AME: prevalence of the secondary mutations in chronic and accelerated phases of chronic myeloid leukemia patients from eastern India.
18671757 2008 Up-regulation of BAALC gene may be an important alteration in AML-M2 patients with t(8;21) translocation.
18378853 2008 High BAALC expression associates with other molecular prognostic markers, poor outcome, and a distinct gene-expression signature in cytogenetically normal patients younger than 60 years with acute myeloid leukemia: a Cancer and Leukemia Group B (CALGB) study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17646667 2007 Low ERG and BAALC expression identifies a new subgroup of adult acute T-lymphoblastic leukemia with a highly favorable outcome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15749074 2005 Baalc, a marker of mesoderm and muscle.
15604894 2005 Molecular heterogeneity and prognostic biomarkers in adults with acute myeloid leukemia and normal cytogenetics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11707601 2001 BAALC, the human member of a novel mammalian neuroectoderm gene lineage, is implicated in hematopoiesis and acute leukemia.