Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession B9ZVM9
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (2)

Protein-protein Interaction (4)

AA Sequence

MLEGQLEAREPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDSNAGEMPSLQQQITSLHQELGRQQSLWAD      1 - 70
IHRKLQSHMDALRKQNRELREELRGLQRQQWEAGKKPAASPHAGRESHTLALEPAFGKISPLSADEETTP     71 - 140
KYAGRKSQSATLLGQRWSSNHLAPPKPMSLKTERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAE    141 - 210
RREVSEDGKIMHPSSRSLQNSGGRKSPVQASQAATLQEQTAAAGVADRSSSVLGSSEGGFLSRVQAEEFA    211 - 280
SSSPDSAERQNLPVNPPSSLEIAQAMDTKMKKEEVQEEKRHPNGKADDCRRSGFPSEFPGALHAAPSRQD    281 - 350
MGP                                                                       351 - 353
//

Text Mined References (3)

PMID Year Title