Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession B9ZVM9
Symbols bA517H2.3

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MLEGQLEAREPKEGTHPEDPCPGAGAAMEKTPAAAEVPREDSNAGEMPSLQQQITSLHQELGRQQSLWAD      1 - 70
IHRKLQSHMDALRKQNRELREELRGLQRQQWEAGKKPAASPHAGRESHTLALEPAFGKISPLSADEETTP     71 - 140
KYAGRKSQSATLLGQRWSSNHLAPPKPMSLKTERINSGKTPPQEDREKSPPGRRQDRSPAPTGRPTPGAE    141 - 210
RREVSEDGKIMHPSSRSLQNSGGRKSPVQASQAATLQEQTAAAGVADRSSSVLGSSEGGFLSRVQAEEFA    211 - 280
SSSPDSAERQNLPVNPPSSLEIAQAMDTKMKKEEVQEEKRHPNGKADDCRRSGFPSEFPGALHAAPSRQD    281 - 350
MGP                                                                       351 - 353
//

Text Mined References (2)

PMID Year Title
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
14574404 2003 The DNA sequence and analysis of human chromosome 6.