Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.80
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
oligodendroglioma -2.300 3.9e-02
astrocytoma -1.100 5.5e-07
glioblastoma -2.200 1.1e-03
osteosarcoma -1.678 2.9e-03
medulloblastoma -2.100 1.3e-02
cystic fibrosis 1.980 8.6e-05
atypical teratoid / rhabdoid tumor -2.800 2.5e-04
medulloblastoma, large-cell -4.800 1.1e-04
adrenocortical carcinoma -1.894 9.8e-04
intraductal papillary-mucinous carcinoma... -2.500 2.3e-03
Breast cancer 2.600 3.0e-02
adult high grade glioma -1.600 4.9e-02
posterior fossa group B ependymoma 1.500 1.2e-04
aldosterone-producing adenoma -1.890 3.1e-02
ovarian cancer -3.400 3.7e-08
pituitary cancer -1.800 2.0e-05
head and neck cancer -1.200 2.1e-03

AA Sequence

MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAERKPGVKHAPYISIAGDDPPASCVFSQ      1 - 70
VMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFG     71 - 140
TLTCWIQAALTLKVNIKNEGRRVGIPRVILSASITLCVVLYFILMAQSIHMYAARVQWGLVMCFLSYFGT    141 - 210
FAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV                                   211 - 249
//

Text Mined References (6)

PMID Year Title
27321926 2016 Tentonin 3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.