Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.80
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
oligodendroglioma -2.300 0.039
astrocytoma -1.100 0.000
glioblastoma -2.200 0.001
osteosarcoma -1.678 0.003
medulloblastoma -2.100 0.013
cystic fibrosis 1.980 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -4.800 0.000
adrenocortical carcinoma -1.894 0.001
intraductal papillary-mucinous carcinoma... -2.500 0.002
Breast cancer 2.600 0.030
adult high grade glioma -1.600 0.049
posterior fossa group B ependymoma 1.500 0.000
aldosterone-producing adenoma -1.890 0.031
ovarian cancer -3.400 0.000
pituitary cancer -1.800 0.000
head and neck cancer -1.200 0.002

Synonym

Accession B9EJG8 B7Z4J5 B7Z4L3 B7Z692 B7Z6X6
Symbols TTN3

Gene

AA Sequence

MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAERKPGVKHAPYISIAGDDPPASCVFSQ      1 - 70
VMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFG     71 - 140
TLTCWIQAALTLKVNIKNEGRRVGIPRVILSASITLCVVLYFILMAQSIHMYAARVQWGLVMCFLSYFGT    141 - 210
FAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV                                   211 - 249
//

Text Mined References (6)

PMID Year Title
27321926 2016 Tentonin 3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.