Property Summary

NCBI Gene PubMed Count 11
Grant Count 129
R01 Count 97
Funding $19,766,788.34
PubMed Score 228.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession B9A064
Symbols IGL
IGLV
VL-MAR

Gene

AA Sequence

MRPKTGQVGCETPEELGPGPRQRWPLLLLGLAMVAHGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRL      1 - 70
LLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISD     71 - 140
FYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP    141 - 210
TECS                                                                      211 - 214
//

Text Mined References (12)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
21880983 2011 Epitope-specific human influenza antibody repertoires diversify by B cell intraclonal sequence divergence and interclonal convergence.
21315556 2011 Utility of Doppler myocardial imaging, cardiac biomarkers, and clonal immunoglobulin genes to assess left ventricular performance and stratify risk following peripheral blood stem cell transplantation in patients with systemic light chain amyloidosis (Al).
17968927 2007 Soft tissue, joint, and bone manifestations of AL amyloidosis: clinical presentation, molecular features, and survival.
16884837 2006 Analysis of the young and elderly variable gene repertoire in response to pneumococcal polysaccharides using a reconstituted SCID mouse model.
15896855 2005 Production and characterization of recombinant human anti-HBs Fab antibodies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
7693035 1993 V gene usage by seven hybrids derived from CD5+ B-cell chronic lymphocytic leukemia and displaying autoantibody activity.
1900243 1991 Expression of a novel type of immunoglobulin C lambda transcripts in human mature B lymphocytes producing kappa light chains.
More...