Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 19.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -2.029 7.9e-03
adult high grade glioma -1.600 3.3e-02
Astrocytoma, Pilocytic -1.900 4.0e-04
atypical teratoid / rhabdoid tumor -1.800 2.7e-04
ependymoma -1.600 2.5e-05
glioblastoma -1.800 4.8e-06
group 4 medulloblastoma -1.900 1.2e-02
lung adenocarcinoma 1.100 4.2e-06
psoriasis -1.400 4.8e-07
subependymal giant cell astrocytoma -3.177 8.2e-03

Synonym

Accession B8ZZ34
Symbols Orf26
C22orf17

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

AA Sequence

MARAGARGLLGGRRPPGLRLALALRLALLLARPPSGRAGAPEAQGPAAPGTTAPEGGDRCRGYYDVMGQW      1 - 70
DPPFNCSSGAYSFCCGTCGYRFCCHDGPRRLDQSRCSNYDTPAWVQTGRPPARARDTAAPRDPGRERSHT     71 - 140
AVYAVCGVAALLVLAGIGARLGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGD    141 - 210
GLPRGSPHNSAGPRTPRLARASPPGEPFMRVAPPGLAAAAAARDSEPGPVPGAGGCGEDRLGSQPRPENG    211 - 280
PPGSHRTASGRGLRRGDSEGGVNRGIGPSRVSLLAPDKKRLNNAPRGSAAPGPPRGPRLQGGGSLTLQPD    281 - 350
YAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSPDLPAPLDACPWAPPVYAPPAAPGPY    351 - 420
AAWTSSRPARPAPLSHPTARAFQVPRRPGHAARRQFSVKMPETFNPQLPGLYGSAGRGSRYLRTNSKTEV    421 - 490
TV                                                                        491 - 492
//

Text Mined References (2)

PMID Year Title