Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00
PubTator Score 19.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession B8ZZ34
Symbols Orf26
C22orf17

Gene

AA Sequence

MARAGARGLLGGRRPPGLRLALALRLALLLARPPSGRAGAPEAQGPAAPGTTAPEGGDRCRGYYDVMGQW      1 - 70
DPPFNCSSGAYSFCCGTCGYRFCCHDGPRRLDQSRCSNYDTPAWVQTGRPPARARDTAAPRDPGRERSHT     71 - 140
AVYAVCGVAALLVLAGIGARLGLERAHSPRARRTVTRALTELLKQPGPQEPLPPTLGPPLGGCVQVQMGD    141 - 210
GLPRGSPHNSAGPRTPRLARASPPGEPFMRVAPPGLAAAAAARDSEPGPVPGAGGCGEDRLGSQPRPENG    211 - 280
PPGSHRTASGRGLRRGDSEGGVNRGIGPSRVSLLAPDKKRLNNAPRGSAAPGPPRGPRLQGGGSLTLQPD    281 - 350
YAKYATFKAAALKAAEAAPRDFCQRFPALEPSPRQPPARAPRPSPDLPAPLDACPWAPPVYAPPAAPGPY    351 - 420
AAWTSSRPARPAPLSHPTARAFQVPRRPGHAARRQFSVKMPETFNPQLPGLYGSAGRGSRYLRTNSKTEV    421 - 490
TV                                                                        491 - 492
//

Text Mined References (2)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
10591208 1999 The DNA sequence of human chromosome 22.