Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.52
PubTator Score 9.25

Knowledge Summary

Patent (115)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
thrombocytopenia-absent radius syndrome 15 5.0

Expression

Synonym

Accession B7ZAQ6 A6NN37 B2RUV3 B3KMN3 B4DLT3 B4DXE7 Q53FQ9 Q5T2V8 Q5T5P5 Q659E2 Q6NVY5 Q9P0S4 Q9Y302
Symbols GPHR
GPR89
SH120
GPR89B
UNQ192

Gene

PANTHER Protein Class (2)

AA Sequence

MSFLIDSSIMITSQILFFGFGWLFFMRQLFKDYEIRQYVVQVIFSVTFAFSCTMFELIIFEILGVLNSSS      1 - 70
RYFHWKMNLCVILLILVFMVPFYIGYFIVSNIRLLHKQRLLFSCLLWLTFMYFFWKLGDPFPILSPKHGI     71 - 140
LSIEQLISRVGVIGVTLMALLSGFGAVNCPYTYMSYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMA    141 - 210
RRTMFQKGEVHNKPSGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKERIEYSKT    211 - 280
FKGKYFNFLGYFFSIYCVWKIFMATINIVFDRVGKTDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGI    281 - 350
IIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSVLLIRMSMPLEYRTIITEVLGELQFN    351 - 420
FYHRWFDVIFLVSALSSILFLYLAHKQAPEKQMAP                                       421 - 455
//

Text Mined References (12)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
19135895 2009 Two novel GPCR-type G proteins are abscisic acid receptors in Arabidopsis.
18794847 2008 GPHR is a novel anion channel critical for acidification and functions of the Golgi apparatus.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
More...