Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.99
PubTator Score 5.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma -1.300 2.3e-04
Astrocytoma, Pilocytic 1.300 6.3e-06
atypical teratoid / rhabdoid tumor -1.200 1.9e-02
cystic fibrosis 1.500 2.7e-04
dermatomyositis 1.100 3.7e-03
ependymoma -1.800 1.2e-09
glioblastoma -1.500 1.0e-02
head and neck cancer -1.700 2.4e-02
interstitial cystitis -1.500 3.4e-04
intraductal papillary-mucinous adenoma (... 1.100 6.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 2.2e-02
invasive ductal carcinoma 1.155 1.9e-03
lung cancer -1.100 4.2e-04
malignant mesothelioma -1.600 4.8e-07
oligodendroglioma -1.600 3.9e-02
osteosarcoma -1.688 5.9e-03
ovarian cancer -1.700 1.2e-06
primary Sjogren syndrome 1.400 8.0e-03
psoriasis -1.300 1.7e-04
spina bifida -1.979 3.8e-02
subependymal giant cell astrocytoma 2.944 2.1e-03
tuberculosis 1.200 4.3e-06
ulcerative colitis 1.500 1.9e-07

Synonym

Accession B7ZAP0 B7ZAA4
Symbols HHL
TBC1D18

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

AA Sequence

MIENSSWSMTFEERENRRLQEASMRLEQENDDLAHELVTSKIALRNDLDQAEDKADVLNKELLLTKQRLV      1 - 70
ETEEEKRKQEEETAQLKEVFRKQLEKAEYEIKKTTAIIAEYKQICSQLSTRLEKQQAASKEELEVVKGKM     71 - 140
MACKHCSDIFSKEGALKLAATGREDQGIETDDEKDSLKKQLREMELELAQTKLQLVEAKCKIQELEHQRG    141 - 210
ALMNEIQAAKNSWFSKTLNSIKTATGTQPLQPAPVTQPPKEST                               211 - 253
//

Text Mined References (19)

PMID Year Title