Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
pancreatic cancer -1.300 0.022
cutaneous lupus erythematosus 2.800 0.000
osteosarcoma -3.205 0.000
glioblastoma 2.200 0.034
sonic hedgehog group medulloblastoma 3.300 0.000
medulloblastoma, large-cell 1.500 0.032
tuberculosis 1.500 0.000
non-small cell lung cancer -1.139 0.000
colon cancer -1.800 0.020
lung cancer 2.600 0.000
ulcerative colitis -1.800 0.000
sarcoidosis 1.600 0.017
adult high grade glioma 2.400 0.004
pancreatic carcinoma -1.300 0.022
lung adenocarcinoma -1.403 0.000
ductal carcinoma in situ -1.700 0.007
invasive ductal carcinoma -1.800 0.028
ovarian cancer -2.400 0.000

AA Sequence

SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVT      1 - 70
CSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTV     71 - 140
AVNFLLTAKLFFL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11459064 2001 Structure of a human gammadelta T-cell antigen receptor.
3413078 1988 Sequence and organization of the diversity, joining, and constant region genes of the human T-cell delta-chain locus.