Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active ulcerative colitis -1.243 5.0e-02
adult high grade glioma 2.200 6.4e-03
colon cancer -1.800 2.0e-02
cutaneous lupus erythematosus 2.800 1.1e-04
ductal carcinoma in situ -1.700 6.8e-03
glioblastoma 1.500 2.4e-02
group 3 medulloblastoma 1.600 2.6e-03
invasive ductal carcinoma -1.800 2.8e-02
lung adenocarcinoma -1.064 2.2e-03
lung cancer -1.800 4.0e-02
medulloblastoma, large-cell 1.500 3.2e-02
non-small cell lung cancer -1.139 5.2e-09
osteosarcoma -3.205 2.6e-04
ovarian cancer -1.700 9.8e-04
pancreatic cancer -1.300 2.2e-02
pancreatic carcinoma -1.300 2.2e-02
sarcoidosis 1.500 3.9e-02
tuberculosis 1.500 3.5e-04

AA Sequence

SQPHTKPSVFVMKNGTNVACLVKEFYPKDIRINLVSSKKITEFDPAIVISPSGKYNAVKLGKYEDSNSVT      1 - 70
CSVQHDNKTVHSTDFEVKTDSTDHVKPKETENTKQPSKSCHKPKAIVHTEKVNMMSLTVLGLRMLFAKTV     71 - 140
AVNFLLTAKLFFL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title