Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession B7Z1M9 B2RXG8
Symbols FAM148D

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MWLLEKAGYKVGAAEPAARWAPSGLFSKRRAPGPPTSACPNVLTPDRIPQFFIPPRLPDPGGAVPAARRH      1 - 70
VAGRGLPATCSLPHLAGREGWAFLPESPHTRRRESLFHGPPPAPAGGLPAAQSRLHVSAPDLRLCRAPDS     71 - 140
DTASSPDSSPFGSPRPGLGRRRVSRPHSLSPEKASSADTSPHSPRRAGPPTPPLFHLDFLCCQLRPTRES    141 - 210
VLRLGPRGGQLRLSTEYQAGPGRLRLRLVSAEGLPRPRSRPGSGGGGCCVVLRLRPRVRPREQQSRVVKC    211 - 280
SANPIFNEDFFFDGLGPPDLAARSLRAKVLDRGAGLRRDVLLGECETPLIALLPPLGGGLGPGSSLAPTH    281 - 350
LSL                                                                       351 - 353
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.