Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.09
PubTator Score 5.67

Knowledge Summary

Patent

No data available

AA Sequence

MTEKFLFLYLSLLPMPLLSQAQWNENSLVSFSKIIASGNHLSNCWICHNFITRSSSYQYILVRNFSLNLT      1 - 70
FGSGIPEGQHKSVPLQVSLANSAHQVPCLDLTPPFNQSSKTSFYFYNCSSLNQTCCPCPEGHCDRKNTSE     71 - 140
EGFPSPTIHPMSFSPAGCHPNLTHWCPAKQMNDYRDKSPQNRCAAWEGKELITWRVLYSLPKAHTVPTWP    141 - 210
KSTVPLGGPLSPACNQTIPAGWKSQLHKWFDSHIPRWACTPPGYVFLCGPQKNKLPFDGSPKITYSTPPV    211 - 280
ANLYTCINNIQHTGECAVGLLGPRGIGVTIYNTTQPRQKRALGLILAGMGAAIGMIAPWGGFTYHDVTLR    281 - 350
NLSRQIDNIAKSTRDSISKLKASIDSLANVVMDNRLALDYLLAEQGGVCAVINKSCCVYVNNSGAIEEDI    351 - 420
KKIYDEATWLHDFGKGGASARAIWEAVKSALPSLNWFVPLLGPATVILLLFLFGPCFFNLLIKCVSSRIK    421 - 490
QFHMKSPQMERYQLSVIGGPSTYKHISPLDASGQRFRETMEEFSL                             491 - 535
//

Text Mined References (8)

PMID Year Title
23555306 2013 Differential evolutionary fate of an ancestral primate endogenous retrovirus envelope gene, the EnvV syncytin, captured for a function in placentation.
23085571 2012 Reactivation of codogenic endogenous retroviral (ERV) envelope genes in human endometrial carcinoma and prestages: Emergence of new molecular targets.
22277806 2012 Transcriptional and functional studies of Human Endogenous Retrovirus envelope EnvP(b) and EnvV genes in human trophoblasts.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18826608 2008 Gene conversion and purifying selection of a placenta-specific ERV-V envelope gene during simian evolution.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15766379 2005 Functional characterization of two newly identified Human Endogenous Retrovirus coding envelope genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.