Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
Funding $430,645
PubMed Score 27.38
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (1)

PMID Text
23555306 In the Old World monkeys, we show that envV is both specifically expressed at the level of the placental syncytiotrophoblast and fusogenic.

AA Sequence

MTEKFLFLYLSLLPMPLLSQAQWNENSLVSFSKIIASGNHLSNCWICHNFITRSSSYQYILVRNFSLNLT      1 - 70
FGSGIPEGQHKSVPLQVSLANSAHQVPCLDLTPPFNQSSKTSFYFYNCSSLNQTCCPCPEGHCDRKNTSE     71 - 140
EGFPSPTIHPMSFSPAGCHPNLTHWCPAKQMNDYRDKSPQNRCAAWEGKELITWRVLYLLPKAHTVPTWP    141 - 210
KSTVPLGGPLSPACNQTIPAGWKSQLHKWFDSHIPRWACTPPGYVFLCGPQKNKLPFDGSPKITYSTPPV    211 - 280
ANLYTCINNIQHTGECAVGLLGPRGIGVTIYNTTQPRQKRALGLILAGMGAAIGMIAPWGGFTYHDVTLR    281 - 350
NLSRQIDNIAKSTRDSISKLKASIDSLANVVMNNRLALDYLLAEQGGVCAVISKSCCIYVNNSGAIEEDI    351 - 420
KKIYDEVTWLHNFGKGDSAGSIWEAVKSALPSLTWFVPLLGPAALNSLLSPLWPLSL                 421 - 477
//

Text Mined References (8)

PMID Year Title
23555306 2013 Differential evolutionary fate of an ancestral primate endogenous retrovirus envelope gene, the EnvV syncytin, captured for a function in placentation.
23085571 2012 Reactivation of codogenic endogenous retroviral (ERV) envelope genes in human endometrial carcinoma and prestages: Emergence of new molecular targets.
21542922 2011 A revised nomenclature for transcribed human endogenous retroviral loci.
18826608 2008 Gene conversion and purifying selection of a placenta-specific ERV-V envelope gene during simian evolution.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.