Property Summary

NCBI Gene PubMed Count 22
PubMed Score 0.00
PubTator Score 0.45

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MSRFFTTGSDSESESSLSGEELVTKPVGGNYGKQPLLLSEDEEDTKRVVRSAKDKRFEELTNLIRTIRNA      1 - 70
MKIRDVTKCLEEFELLGKAYGKAKSIVDKEGVPRFYIRILADLEDYLNELWEDKEGKKKMNKNNAKALST     71 - 140
LRQKIRKYNRDFESHITSYKQNPEQSADEDAEKNEEDSEGSSDEDEDEDGVSAATFLKKKSEAPSGESRK    141 - 210
FLKKMDDEDEDSEDSEDDEDWDTGSTSSDSDSEEEEGKQTALASRFLKKAPTTDEDKKAAEKKREDKAKK    211 - 280
KHDRKSKRLDEEEEEDNEGGEWERVRGGVPLVKEKPKMFAKGTEITHAVVIKKLNEILQARGKKGTDRAA    281 - 350
QIELLQLLVQIAAENNLGEGVIVKIKFNIIASLYDYNPNLATYMKPEMWGKCLDCINELMDILFANPNIF    351 - 420
VGENILEESENLHNADQPLRVRGCILTLVERMDEEFTKIMQNTDPHSQEYVEHLKDEAQVCAIIERVQRY    421 - 490
LEEKGTTEEVCRIYLLRILHTYYKFDYKAHQRQLTPPEGSSKSEQDQAENEGEDSAVLMERLCKYIYAKD    491 - 560
RTDRIRTCAILCHIYHHALHSRWYQARDLMLMSHLQDNIQHADPPVQILYNRTMVQLGICAFRQGLTKDA    561 - 630
HNALLDIQSSGRAKELLGQGLLLRSLQERNQEQEKVERRRQVPFHLHINLELLECVYLVSAMLLEIPYMA    631 - 700
AHESDARRRMISKQFHHQLRVGERQPLLGPPESMREHVVAASKAMKMGDWKTCHSFIINEKMNGKVWDLF    701 - 770
PEADKVRTMLVRKIQEESLRTYLFTYSSVYDSISMETLSDMFELDLPTVHSIISKMIINEELMASLDQPT    771 - 840
QTVVMHRTEPTAQQNLALQLAEKLGSLVENNERVFDHKQGTYGGYFRDQKDGYRKNEGYMRRGGYRQQQS    841 - 910
QTAY                                                                      911 - 914
//

Text Mined References (23)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18599441 2008 Mass spectrometry reveals modularity and a complete subunit interaction map of the eukaryotic translation factor eIF3.
18187866 2008 Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column.
17581632 2007 Reconstitution reveals the functional core of mammalian eIF3.
17322308 2007 Structural characterization of the human eukaryotic initiation factor 3 protein complex by mass spectrometry.
17287340 2007 Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16322461 2005 Structural roles for human translation factor eIF3 in initiation of protein synthesis.
More...