Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.100 0.000

Synonym

Accession B5MCN3
Symbols

Gene

PANTHER Protein Class (1)

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MSGQVGDLSPSQEKSLAQFRENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQQDLAN      1 - 70
ILAWQPPEVVRLYNANGICGHDGEGSPVWYHIVGSLDPKGLLLSASKQELLRDSFRSCELLLRECELQSQ     71 - 140
KLGKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMS    141 - 210
EETRRKVVILGDNWKQELTKFISPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKSYYLCKQVRLQYEH    211 - 280
TRSVGRGSSLQVENEILFPGCVLRWQFASDGGDIGFGVFLKTKMGERQRAREMTEVLPSQRYNAHMVPED    281 - 350
GILTCLQAGSYVLRFYNTYSLVHSKRISYTVEVLLPDQTFMEKMEKF                           351 - 397
//

Text Mined References (3)

PMID Year Title
17428729 2007 The lipid-binding SEC14 domain.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
10591208 1999 The DNA sequence of human chromosome 22.