Tbio | Beta-1,4-galactosyltransferase 6 |
Required for the biosynthesis of glycosphingolipids.
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene is a lactosylceramide synthase important for glycolipid biosynthesis. [provided by RefSeq, Jul 2008]
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene is a lactosylceramide synthase important for glycolipid biosynthesis. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
lung carcinoma | 2843 | 1.7e-21 |
oligodendroglioma | 2850 | 3.2e-09 |
ovarian cancer | 8520 | 1.1e-07 |
cystic fibrosis | 1696 | 1.9e-06 |
Breast cancer | 3578 | 3.9e-05 |
invasive ductal carcinoma | 2951 | 2.2e-04 |
medulloblastoma, large-cell | 6241 | 2.2e-04 |
glioblastoma | 5792 | 3.2e-04 |
pituitary cancer | 1972 | 8.4e-04 |
nasopharyngeal carcinoma | 1058 | 3.2e-03 |
Pick disease | 1894 | 3.7e-03 |
adrenocortical carcinoma | 1428 | 4.6e-03 |
adult high grade glioma | 3801 | 7.0e-03 |
astrocytic glioma | 2597 | 1.3e-02 |
primitive neuroectodermal tumor | 3035 | 1.4e-02 |
mucosa-associated lymphoid tissue lymphoma | 484 | 1.7e-02 |
atypical teratoid / rhabdoid tumor | 5112 | 1.7e-02 |
osteosarcoma | 7950 | 2.6e-02 |
non primary Sjogren syndrome sicca | 891 | 2.7e-02 |
subependymal giant cell astrocytoma | 2287 | 2.9e-02 |
aldosterone-producing adenoma | 665 | 3.0e-02 |
Alzheimer's disease | 658 | 4.3e-02 |
medulloblastoma | 720 | 4.3e-02 |
ependymoma | 4679 | 4.5e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Amyotrophic lateral sclerosis | 451 | 0.0 | 1.7 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Osteochondrosis | 17 | 3.351 | 1.7 |
Disease | log2 FC | p |
---|---|---|
adrenocortical carcinoma | -1.287 | 4.6e-03 |
adult high grade glioma | -1.400 | 7.0e-03 |
aldosterone-producing adenoma | -1.164 | 3.0e-02 |
Alzheimer's disease | -1.100 | 4.3e-02 |
astrocytic glioma | -1.100 | 1.3e-02 |
atypical teratoid / rhabdoid tumor | -1.100 | 1.7e-02 |
Breast cancer | -1.200 | 3.9e-05 |
cystic fibrosis | 1.856 | 1.9e-06 |
ependymoma | -1.300 | 4.5e-02 |
glioblastoma | -1.400 | 3.2e-04 |
invasive ductal carcinoma | -1.100 | 2.2e-04 |
lung carcinoma | 2.900 | 1.7e-21 |
medulloblastoma | -1.100 | 4.3e-02 |
medulloblastoma, large-cell | -2.400 | 2.2e-04 |
mucosa-associated lymphoid tissue lympho... | -1.087 | 1.7e-02 |
nasopharyngeal carcinoma | 1.700 | 3.2e-03 |
non primary Sjogren syndrome sicca | -1.100 | 2.7e-02 |
oligodendroglioma | -1.300 | 3.2e-09 |
osteosarcoma | -1.205 | 2.6e-02 |
ovarian cancer | -2.400 | 1.1e-07 |
Pick disease | -1.200 | 3.7e-03 |
pituitary cancer | 1.300 | 8.4e-04 |
primitive neuroectodermal tumor | -1.700 | 1.4e-02 |
subependymal giant cell astrocytoma | -2.518 | 2.9e-02 |
Accession | Q9UBX8 O60514 Q6NT09 Beta-1,4-GalTase 6 |
Symbols |
B4Gal-T6 beta4Gal-T6 |
Species | Source | Disease |
---|---|---|
OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA | ||
Inparanoid OMA |
MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNK 1 - 70 NSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLD 71 - 140 IEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNV 141 - 210 GFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKI 211 - 280 NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGL 281 - 350 NNLIYRPKILVDRLYTNISVNLMPELAPIEDY 351 - 382 //