Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.38
PubTator Score 3.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical carcinoma -1.287 4.6e-03
adult high grade glioma -1.400 7.0e-03
aldosterone-producing adenoma -1.164 3.0e-02
Alzheimer's disease -1.100 4.3e-02
astrocytic glioma -1.100 1.3e-02
atypical teratoid / rhabdoid tumor -1.100 1.7e-02
Breast cancer -1.200 3.9e-05
cystic fibrosis 1.856 1.9e-06
ependymoma -1.300 4.5e-02
glioblastoma -1.400 3.2e-04
invasive ductal carcinoma -1.100 2.2e-04
lung carcinoma 2.900 1.7e-21
medulloblastoma -1.100 4.3e-02
medulloblastoma, large-cell -2.400 2.2e-04
mucosa-associated lymphoid tissue lympho... -1.087 1.7e-02
nasopharyngeal carcinoma 1.700 3.2e-03
non primary Sjogren syndrome sicca -1.100 2.7e-02
oligodendroglioma -1.300 3.2e-09
osteosarcoma -1.205 2.6e-02
ovarian cancer -2.400 1.1e-07
Pick disease -1.200 3.7e-03
pituitary cancer 1.300 8.4e-04
primitive neuroectodermal tumor -1.700 1.4e-02
subependymal giant cell astrocytoma -2.518 2.9e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MSVLRRMMRVSNRSLLAFIFFFSLSSSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNK      1 - 70
NSTLNGTDYPEGNNSSDYLVQTTTYLPENFTYSPYLPCPEKLPYMRGFLNVNVSEVSFDEIHQLFSKDLD     71 - 140
IEPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNV    141 - 210
GFKEAMKDSVWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKI    211 - 280
NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYKSIPHHHRGEVQFLGRYKLLRYSKERQYIDGL    281 - 350
NNLIYRPKILVDRLYTNISVNLMPELAPIEDY                                          351 - 382
//

Text Mined References (11)

PMID Year Title