Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.17
PubTator Score 8.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
ductal carcinoma in situ 1.100 8.2e-04
invasive ductal carcinoma 1.100 2.3e-03
Multiple myeloma 1.376 1.7e-03
ovarian cancer 1.700 7.6e-06

Gene RIF (13)

AA Sequence

MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPA      1 - 70
PQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRL     71 - 140
LLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCD    141 - 210
PRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPP    211 - 280
TSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPR    281 - 350
APSGPRYPPGSSQAFRQEMLQRRPPARPGPLSTANHTALRGSH                               351 - 393
//

Text Mined References (16)

PMID Year Title