Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.16
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2627 3.2e-13
primary Sjogren syndrome 710 9.1e-05
osteosarcoma 7766 1.8e-04
lung cancer 4607 9.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.800 3.2e-13
lung cancer 1.100 9.4e-03
osteosarcoma 1.265 1.8e-04
primary Sjogren syndrome -1.200 9.1e-05

Gene RIF (12)

AA Sequence

MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSARGPAHALHPAASSSSSSSNCSRP      1 - 70
NATASSSGLPEVPSALPGPTAPTLPPCPDSPPGLVGRLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCT     71 - 140
PAQTVAVIIPFRHREHHLRYWLHYLHPILRRQRLRYGVYVINQHGEDTFNRAKLLNVGFLEALKEDAAYD    141 - 210
CFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDKFGFRLPYAGYFGGVSGLSKAQFLRINGFPNEYWGWGG    211 - 280
EDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVS    281 - 350
RQPLFTNITVDIGRPPSWPPRG                                                    351 - 372
//

Text Mined References (16)

PMID Year Title