Property Summary

NCBI Gene PubMed Count 65
PubMed Score 197.54
PubTator Score 182.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma -1.300 3.6e-05
psoriasis -4.100 2.8e-06
osteosarcoma -2.234 4.9e-07
cystic fibrosis 1.059 5.5e-03
astrocytoma 1.700 1.5e-02
glioblastoma 1.800 5.1e-03
medulloblastoma, large-cell 1.100 1.2e-04
lung cancer -2.300 1.0e-03
adult high grade glioma -1.100 4.5e-03
lung carcinoma -1.400 3.9e-25
ovarian cancer 1.300 1.3e-04

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26315939 We suggest that the unique expression patterns for the B4GALT1 in normal and malignant tissues are controlled by a differential usage of 5'-B4GALT1 regulatory units along with a post-transcriptional regulation by the antisense RNA
26191157 Human chorionic gonadotropin provides a mechanism to bridge embryo to endometrium through beta1,4-GalT.
25936519 HS5 cells had significantly enhanced levels of bisecting N-glycans (catalyzed by MGAT3 whereas HS27a cells had enhanced levels of Galbeta1,4GlcNAc.
25223470 plays a role in activation of T-lymphocytes and participates in intercellular contact formation
23744354 B4GALT1 and B4GALT5, two members of B4GALT gene family, are involved in the development of multidrug resistance of human leukemia cells.
23583406 RNAi-mediated knockdown of beta1,4GT1 increased the levels of EGFR dimerization and phosphorylation. These data suggest that cell surface beta1,4GT1 interacts with EGFR and inhibits EGFR activatio
22982306 estrogen regulates the expression of B4GALT1 through the direct binding of ER-alpha to ERE; the expressed B4GALT1 plays a crucial role in the proliferation of MCF-7 cells through its activity as a membrane receptor.
22927297 the glycogene B4GALT1 represent a valuable candidate biomarker of invasive phenotype of colorectal cancer.
22847114 Osteopontin increases the expression of beta1, 4-Galactosyltransferase-I and promotes adhesion in human RL95-2 cells, the activity critical for embryo implantation.
22740701 beta4Gal-T1 molecule has two different oligosaccharide binding regions for the binding of the extended oligosaccharide moiety of the acceptor substrate.
21750942 expression of beta1,4-GalT-I increased in the cartilage and synovial tissue of osteoarthritis (OA) patients compared with healthy controls; data suggest that beta1,4-GalT-I may play an important role in the inflammatory processes in cartilage and synovial tissue of patients with OA
20886274 TNF-alpha contributes to the up-regulation of beta1,4-GalT-I mRNA in human fibroblast-like synoviocytes.
20851383 B4GalTI might act as a key adhesion molecule participating in T cell-dendritic cell contacts.
20655926 The mutation of C80S introduces a fully occupied UDP binding site at the enzyme dimer interface that is observed to be dependent on the binding of H antigen acceptor analog.
20619088 PKC signal transduction pathway participates in regulating beta-1, 4-GalT-I expression in endothelial cells stimulated by TNF-alpha.
20490888 These results suggested that beta1,4-Galactosyltransferase-I may play an important role in the inflammatory processes in synovial tissue of patients with rheumatoid arthritis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378551 Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells
20202494 found that both the long and short isoforms of beta-1,4-GalT-I were expressed in human CD4(+) T lymphocytes, and localized in the cytoplasm and on the plasma membrane.
19261593 These results demonstrate that B3GNT1 and B4GALT1 physically associate in vitro and in cultured cells, providing insight into possible mechanisms for regulation of polyLacNAc production.
19204726 Observational study of gene-disease association. (HuGE Navigator)
19106107 Deoxygenated disaccharide analogs as specific inhibitors of beta1-4-galactosyltransferase 1 and selectin-mediated tumor metastasis.
18929424 hepatitis B-induced GalT I expression might contribute to hepatitis B-mediated hepatocellular carcinoma development and progression
18330979 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18314154 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
18215327 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
17021253 Cycling between the trans-Golgi cisterna and the trans-Golgi network of galT is signal mediated.
16786197 These results demonstrated that cell surface beta1,4GT1 may negatively regulate cell survival possibly through inhibiting and modulating EGFR signaling pathway.
16675551 Data show that expression of a hybrid enzyme of Arabidopsis thaliana xylosyltransferase and human beta-1,4-galactosyltransferase I in tobacco causes a reduction of N-glycans with potentially immunogenic core-bound xylose and fucose residues.
16157350 beta4Gal-T1 interacts preferentially with the 1,2-1,6-arm trisaccharide rather than with the 1,2-1,3-arm or 1,4-1,3-arm of a bi- or tri-antennary oligosaccharide chain of N-glycan
15668241 TNFalpha modulates the glycosylation of endothelial cells by a mechanism that directly enhances the stability of beta4GalT-1 mRNA transcripts
15611127 E1AF has an essential role in the activation of the human GalT I gene in highly metastatic lung cancer cells
11901181 deficiency causes a new congenital disorder of glycosylation (CDG), designated type IId (CDG-IId), a severe neurologic disease characterized by hydrocephalus, myopathy, and blood-clotting defects
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2649653 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2542563 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2541446 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
2187500 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus

AA Sequence

MRLREPLLSGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLSRLPQLVGVSTPLQGGSNSAAAI      1 - 70
GQSSGELRTGGARPPPPLGASSQPRPGGDSSPVVDSGPGPASNLTSVPVPHTTALSLPACPEESPLLVGP     71 - 140
MLIEFNMPVDLELVAKQNPNVKMGGRYAPRDCVSPHKVAIIIPFRNRQEHLKYWLYYLHPVLQRQQLDYG    141 - 210
IYVINQAGDTIFNRAKLLNVGFQEALKDYDYTCFVFSDVDLIPMNDHNAYRCFSQPRHISVAMDKFGFSL    211 - 280
PYVQYFGGVSALSKQQFLTINGFPNNYWGWGGEDDDIFNRLVFRGMSISRPNAVVGRCRMIRHSRDKKNE    281 - 350
PNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS                          351 - 398
//

Text Mined References (68)

PMID Year Title
26315939 2015 Multifaceted roles of 5'-regulatory region of the cancer associated gene B4GALT1 and its comparison with the gene family.
26191157 2015 HCG induces ?1,4-GalT I expression and promotes embryo implantation.
25936519 2015 Quantitative analysis of glycans, related genes, and proteins in two human bone marrow stromal cell lines using an integrated strategy.
25223470 2014 ?-1,4-galactosyltransferase-I activates proliferation and participates in intercellular contacts of lymphocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23744354 2013 B4GALT family mediates the multidrug resistance of human leukemia cells by regulating the hedgehog pathway and the expression of p-glycoprotein and multidrug resistance-associated protein 1.
23583406 2013 Direct interaction between surface ?1,4-galactosyltransferase 1 and epidermal growth factor receptor (EGFR) inhibits EGFR activation in hepatocellular carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22982306 2012 Estrogen induced ?-1,4-galactosyltransferase 1 expression regulates proliferation of human breast cancer MCF-7 cells.
22927297 2012 Aberrant promoter methylation of beta-1,4 galactosyltransferase 1 as potential cancer-specific biomarker of colorectal tumors.
22847114 2012 Osteopontin increases the expression of ?1, 4-galactosyltransferase-I and promotes adhesion in human RL95-2 cells.
22740701 2012 Binding of N-acetylglucosamine (GlcNAc) ?1-6-branched oligosaccharide acceptors to ?4-galactosyltransferase I reveals a new ligand binding mode.
21750942 2012 Elevated expression of ?1,4-galactosyltransferase-I in cartilage and synovial tissue of patients with osteoarthritis.
20886274 2011 Tumor necrosis factor-? up-regulates the expression of ?1,4-galactosyltransferase-I in human fibroblast-like synoviocytes.
20851383 2010 The expression and function of ?-1,4-galactosyltransferase-I in dendritic cells.
20655926 2010 Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding.
20619088 2010 [The role of PKC to TNF-alpha induced beta-1, 4-galactosyltransferase-I expression in endothelial cells].
20490888 2010 ?1,4-Galactosyltransferase-I contributes to the inflammatory processes in synovial tissue of patients with rheumatoid arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378551 2010 Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells.
20202494 2010 Expression of beta-1,4-galactosyltransferase-I affects cellular adhesion in human peripheral blood CD4+ T cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19261593 2009 Association of beta-1,3-N-acetylglucosaminyltransferase 1 and beta-1,4-galactosyltransferase 1, trans-Golgi enzymes involved in coupled poly-N-acetyllactosamine synthesis.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19106107 2009 Deoxygenated disaccharide analogs as specific inhibitors of beta1-4-galactosyltransferase 1 and selectin-mediated tumor metastasis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18929424 2008 Identification of beta-1,4-galactosyltransferase I as a target gene of HBx-induced cell cycle progression of hepatoma cell.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17021253 2006 Transition of galactosyltransferase 1 from trans-Golgi cisterna to the trans-Golgi network is signal mediated.
16786197 2006 Cell surface beta 1, 4-galactosyltransferase 1 promotes apoptosis by inhibiting epidermal growth factor receptor pathway.
16675551 2006 An antibody produced in tobacco expressing a hybrid beta-1,4-galactosyltransferase is essentially devoid of plant carbohydrate epitopes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16497331 2006 Structural snapshots of beta-1,4-galactosyltransferase-I along the kinetic pathway.
16157350 2005 Oligosaccharide preferences of beta1,4-galactosyltransferase-I: crystal structures of Met340His mutant of human beta1,4-galactosyltransferase-I with a pentasaccharide and trisaccharides of the N-glycan moiety.
15668241 2005 Tumor necrosis factor-alpha up-regulates the expression of beta1,4-galactosyltransferase I in primary human endothelial cells by mRNA stabilization.
15611127 2005 Elevated beta1,4-galactosyltransferase I in highly metastatic human lung cancer cells. Identification of E1AF as important transcription activator.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11947697 1970 Purification of lactose synthetase a protein from human milk and demonstration of its interaction with alpha-lactalbumin.
11901181 2002 Deficiency of UDP-galactose:N-acetylglucosamine beta-1,4-galactosyltransferase I causes the congenital disorder of glycosylation type IId.
11506180 2001 Effect of p58GTA on beta-1,4-galactosyltransferase 1 activity and cell-cycle in human hepatocarcinoma cells.
11419947 2001 Crystal structure of lactose synthase reveals a large conformational change in its catalytic component, the beta1,4-galactosyltransferase-I.
11295846 2001 A novel b(1-4)galactosyltransferase gene silent mutation (594C>T) associated with Hutchinson-Gilford progeria.
10900002 2000 Localization of alpha 1,3-fucosyltransferase VI in Weibel-Palade bodies of human endothelial cells.
10580128 1999 Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions.
9597550 1998 The expanding beta 4-galactosyltransferase gene family: messages from the databanks.
8540625 1995 Immunocytochemical localization of the protein reactive to human beta-1, 4-galactosyltransferase antibodies during chick embryonic skin differentiation.
7744867 1995 Golgi retention mechanism of beta-1,4-galactosyltransferase. Membrane-spanning domain-dependent homodimerization and association with alpha- and beta-tubulins.
7579794 1995 The beta 1,4-galactosyltransferase gene is post-transcriptionally regulated during differentiation of mouse F9 teratocarcinoma cells.
7540104 1995 Analysis of the sequences of human beta-1,4-galactosyltransferase cDNA clones.
6121819 1982 Immunocytochemical localization of galactosyltransferase in HeLa cells: codistribution with thiamine pyrophosphatase in trans-Golgi cisternae.
3917437 1985 Immunocytochemical demonstration of ecto-galactosyltransferase in absorptive intestinal cells.
3144273 1988 Identification of the full-length coding sequence for human galactosyltransferase (beta-N-acetylglucosaminide: beta 1,4-galactosyltransferase).
3098628 1986 Several galactosyltransferase activities are associated with mouse chromosome 17.
3094506 1986 Isolation of a cDNA coding for human galactosyltransferase.
3091013 1986 Isolation of galactosyltransferase from human milk and the determination of its N-terminal amino acid sequence.
2124683 1990 Near identity of HeLa cell galactosyltransferase with the human placental enzyme.
2120039 1990 Analysis of the substrate binding sites of human galactosyltransferase by protein engineering.
1903938 1991 Genomic structure and expression of human beta-1,4-galactosyltransferase.
1714903 1991 Evidence for a molecular distinction between Golgi and cell surface forms of beta 1,4-galactosyltransferase.
1384956 1992 Complementary DNA cloning for galactosyltransferase associated with tumor and determination of antigenic epitopes recognized by specific monoclonal antibodies.
33805 1979 The charge heterogeneity of soluble human galactosyltransferases isolated from milk, amniotic fluid and malignant ascites.