Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.1e-03
adult high grade glioma 2148 6.2e-03
fibroadenoma 557 2.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
fibroadenoma 1.500 2.8e-02
adult high grade glioma -1.400 6.2e-03
lung adenocarcinoma 1.200 2.1e-03

Gene RIF (6)

PMID Text
25858323 These results indicate that the expression of the LacdiNAc group is quite important for the suppression of malignancies of the MDA-MB-231 cells.
22722940 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
22722937 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases beta1,4-N-acetylgalactosaminyl transferase 3 (beta4GalNAc-T3) and beta4GalNAc-T4.
18854154 Knockdown of beta-1,4-N-acetyl-galactosaminyl transferase 4 (B4GALNT4) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18048353 betaGT3 and betaGT4, that are able to transfer GalNAc to GlcNAc in beta1,4-linkage display the necessary glycoprotein specificity in vivo.
15044014 molecular cloning and characterization; specificity toward oligosaccharide acceptor substrates was quite similar to beta4GalNAc-T3 in vitro but the tissue distributions of the two enzymes were quite different

AA Sequence

MPRLPVKKIRKQMKLLLLLLLLSCAAWLTYVHLGLVRQGRALRQRLGYGRDGEKLTSETDGRGVHAAPST      1 - 70
QRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEYKGQVNLHVFEDWCGGAVGHLRRN     71 - 140
LHFPLFPHTRTTVKKLAVSPKWKNYGLRIFGFIHPARDGDVQFSVASDDNSEFWLSLDESPAAAQLVAFV    141 - 210
GKTGSEWTAPGEFTKFSSQVSKPRRLMASRRYYFELLHKQDDRGSDHVEVGWRAFLPGLKFEVISSAHIS    211 - 280
LYTDESALKMDHVAHVPQSPASHVGGRPPQEETSADMLRPDPRDTFFLTPRMESSSLENVLEPCAYAPTY    281 - 350
VVKDFPIARYQGLQFVYLSFVYPNDYTRLTHMETDNKCFYRESPLYLERFGFYKYMKMDKEEGDEDEEDE    351 - 420
VQRRAFLFLNPDDFLDDEDEGELLDSLEPTEAAPPRSGPQSPAPAAPAQPGATLAPPTPPRPRDGGTPRH    421 - 490
SRALSWAARAARPLPLFLGRAPPPRPAVEQPPPKVYVTRVRPGQRASPRAPAPRAPWPPFPGVFLHPRPL    491 - 560
PRVQLRAPPRPPRPHGRRTGGPQATQPRPPARAQATQGGREGQARTLGPAAPTVDSNLSSEARPVTSFLS    561 - 630
LSQVSGPQLPGEGEEEEEGEDDGAPGDEAASEDSEEAAGPALGRWREDAIDWQRTFSVGAVDFELLRSDW    631 - 700
NDLRCNVSGNLQLPEAEAVDVTAQYMERLNARHGGRFALLRIVNVEKRRDSARGSRFLLELELQERGGGR    701 - 770
LRLSEYVFLRLPGARVGDADGESPEPAPAASVRPDGRPELCRPLRLAWRQDVMVHFIVPVKNQARWVAQF    771 - 840
LADMAALHARTGDSRFSVVLVDFESEDMDVERALRAARLPRYQYLRRTGNFERSAGLQAGVDAVEDASSI    841 - 910
VFLCDLHIHFPPNILDGIRKHCVEGRLAFAPVVMRLSCGSSPRDPHGYWEVNGFGLFGIYKSDFDRVGGM    911 - 980
NTEEFRDQWGGEDWELLDRVLQAGLEVERLRLRNFYHHYHSKRGMWSVRSRKGSRTGAS               981 - 1039
//

Text Mined References (8)

PMID Year Title
25858323 2015 Enhanced expression of the ?4-N-acetylgalactosaminyltransferase 4 gene impairs tumor growth of human breast cancer cells.
22722940 2012 Peptide-specific transfer of N-acetylgalactosamine to O-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
22722937 2012 Molecular basis for protein-specific transfer of N-acetylgalactosamine to N-linked glycans by the glycosyltransferases ?1,4-N-acetylgalactosaminyl transferase 3 (?4GalNAc-T3) and ?4GalNAc-T4.
18048353 2008 A necessary and sufficient determinant for protein-selective glycosylation in vivo.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15044014 2004 Molecular cloning and characterization of beta1,4-N-acetylgalactosaminyltransferases IV synthesizing N,N'-diacetyllactosediamine.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.