Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6514 2.1e-12


Accession B4E2M5


  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 HCA RNA Cell Line (1)

AA Sequence

DWDAKKRELELSLPSLNQNMNKKNKKSRGPTRPSNTKGRRV                                 211 - 251

Text Mined References (3)

PMID Year Title