Property Summary

NCBI Gene PubMed Count 8
Grant Count 4
R01 Count 4
Funding $418,608
PubMed Score 5.76
PubTator Score 1.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.500 0.009
posterior fossa group A ependymoma -2.300 0.000
glioblastoma multiforme -1.200 0.000
group 3 medulloblastoma -2.700 0.003
atypical teratoid / rhabdoid tumor -1.700 0.001
medulloblastoma, large-cell -1.400 0.040
adult high grade glioma -1.300 0.041
pilocytic astrocytoma 1.500 0.002
ovarian cancer 1.100 0.000
pituitary cancer -1.400 0.000
psoriasis -1.200 0.000

Synonym

Accession B4DS77 C9J314 C9JCE9
Symbols CKAMP44

Gene

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20185686 Functionally characterizes the homologous mouse gene.

AA Sequence

MRRVLRLLLGCFLTELCARVCRAQERAGHGQLAQLGGVLLLAGGNRSGAASGEASEGAEASDAPPTRAPT      1 - 70
PDFCRGYFDVMGQWDPPFNCSSGDFIFCCGTCGFRFCCTFKKRRLNQSTCTNYDTPLWLNTGKPPARKDD     71 - 140
PLHDPTKDKTNLIVYIICGVVAVMVLVGIFTKLGLEKAHRPQREHMSRALADVMRPQGHCNTDHMERDLN    141 - 210
IVVHVQHYENMDTRTPINNLHATQMNNAVPTSPLLQQMGHPHSYPNLGQISNPYEQQPPGKELNKYASLK    211 - 280
AVGSSDGDWAVSTLKSPKADKVNDDFYTKRRHLAELAAKGNLPLHPVRVEDEPRAFSPEHGPAKQNGQKS    281 - 350
RTNKMPPHPLAYTSTTNFKGWDPNEQSLRRQAYSNKGKLGTAETGSSDPLGTRPQHYPPPQPYFITNSKT    351 - 420
EVTV                                                                      421 - 424
//

Text Mined References (9)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
20185686 2010 CKAMP44: a brain-specific protein attenuating short-term synaptic plasticity in the dentate gyrus.
18677311 2008 Identification of loci associated with schizophrenia by genome-wide association and follow-up.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.