Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.49
PubTator Score 1.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.300 4.1e-02
astrocytic glioma -1.400 3.2e-03
Astrocytoma, Pilocytic 1.500 1.6e-03
atypical teratoid / rhabdoid tumor -1.700 7.2e-04
ependymoma -1.200 2.7e-02
glioblastoma multiforme -1.200 1.2e-18
group 3 medulloblastoma -2.700 3.3e-03
medulloblastoma, large-cell -1.400 4.0e-02
ovarian cancer 1.100 3.2e-11
pituitary cancer -1.400 5.5e-05
psoriasis -1.200 4.7e-36

 GO Function (1)

 MGI Phenotype (1)

Gene RIF (2)

AA Sequence

MRRVLRLLLGCFLTELCARVCRAQERAGHGQLAQLGGVLLLAGGNRSGAASGEASEGAEASDAPPTRAPT      1 - 70
PDFCRGYFDVMGQWDPPFNCSSGDFIFCCGTCGFRFCCTFKKRRLNQSTCTNYDTPLWLNTGKPPARKDD     71 - 140
PLHDPTKDKTNLIVYIICGVVAVMVLVGIFTKLGLEKAHRPQREHMSRALADVMRPQGHCNTDHMERDLN    141 - 210
IVVHVQHYENMDTRTPINNLHATQMNNAVPTSPLLQQMGHPHSYPNLGQISNPYEQQPPGKELNKYASLK    211 - 280
AVGSSDGDWAVSTLKSPKADKVNDDFYTKRRHLAELAAKGNLPLHPVRVEDEPRAFSPEHGPAKQNGQKS    281 - 350
RTNKMPPHPLAYTSTTNFKGWDPNEQSLRRQAYSNKGKLGTAETGSSDPLGTRPQHYPPPQPYFITNSKT    351 - 420
EVTV                                                                      421 - 424
//

Text Mined References (9)

PMID Year Title