Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFSIMSLNSYNDG      1 - 70
DYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA                                    71 - 109
//

Text Mined References (4)

PMID Year Title
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16541075 2006 The finished DNA sequence of human chromosome 12.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.