Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MSQYAPSPDFKRALDSSPEANTEDDKTEEDVPMPKNYLWLTIVSCFCPAYPINIVALVFSIMSLNSYNDG      1 - 70
DYEGARRLGRNAKWVAIASIIIGLLIIGISCAVHFTRNA                                    71 - 109
//

Text Mined References (5)

PMID Year Title