Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.45
PubTator Score 2.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
gastric carcinoma 1.200 2.7e-02
intraductal papillary-mucinous adenoma (... 1.100 1.9e-04
intraductal papillary-mucinous carcinoma... 1.100 9.6e-04
osteosarcoma -2.108 9.5e-06

Synonym

Accession Q67FW5 Q6GV30 Q8WUT3 BGnT-like protein 1
Symbols B3GNT8
BGnT-8
beta-1
3-Gn-T8
beta3Gn-T8
beta3GnTL1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWR      1 - 70
VKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGC     71 - 140
RVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMPTWFCSRAWFSHVGPFNEGGQGVPEDLLFFY    141 - 210
EHLRKGGGVIRVDQSLLLYRHHPQAATHCVLETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSL    211 - 280
TAGSQRKVVAFCDVDENKIRKGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLH    281 - 350
LQEGQDFLHFS                                                               351 - 361
//

Text Mined References (6)

PMID Year Title