Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.36
PubTator Score 7.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma 1.600 1.1e-04
Astrocytoma, Pilocytic 1.900 3.0e-06
atypical teratoid / rhabdoid tumor 1.100 1.1e-03
Breast cancer -2.700 6.4e-07
breast carcinoma -1.100 1.8e-13
chronic rhinosinusitis -1.646 3.5e-02
cystic fibrosis 1.131 4.4e-05
ependymoma 1.400 4.9e-02
glioblastoma 2.300 5.3e-10
group 4 medulloblastoma 1.400 5.8e-04
intraductal papillary-mucinous carcinoma... 1.600 4.9e-02
intraductal papillary-mucinous neoplasm ... 2.500 1.1e-02
juvenile dermatomyositis 1.470 4.8e-13
medulloblastoma, large-cell 1.100 1.8e-04
non-small cell lung cancer 1.113 4.6e-05
osteosarcoma 1.894 5.5e-05
pancreatic cancer 1.900 1.3e-02
pancreatic ductal adenocarcinoma liver m... 2.575 1.3e-02
pituitary cancer -1.100 3.5e-04
primitive neuroectodermal tumor 2.800 1.9e-07
tuberculosis -1.300 1.5e-05

Gene RIF (3)

AA Sequence

MRMLVSGRRVKKWQLIIQLFATCFLASLMFFWEPIDNHIVSHMKSYSYRYLINSYDFVNDTLSLKHTSAG      1 - 70
PRYQYLINHKEKCQAQDVLLLLFVKTAPENYDRRSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGE     71 - 140
ELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKFLMTADDDIFIHMPNLIEYLQSL    141 - 210
EQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYEASQTLNSSLY    211 - 280
IDDVFMGLCANKIGIVPQDHVFFSGEGKTPYHPCIYEKMMTSHGHLEDLQDLWKNATDPKVKTISKGFFG    281 - 350
QIYCRLMKIILLCKISYVDTYPCRAAFI                                              351 - 378
//

Text Mined References (10)

PMID Year Title