Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.18
PubTator Score 4.56

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... 1.014 1.9e-02
intraductal papillary-mucinous carcinoma... 1.100 1.0e-03
pancreatic cancer 1.100 6.0e-05
lung adenocarcinoma 3.300 2.8e-12
psoriasis 1.300 4.0e-20

Gene RIF (5)

PMID Text
26709519 This study demonstrated that elevated B3GNT3 expression is associated with pelvic lymph node metastasis and poor outcome in early-stage cervical cancer patients.
24118321 B3GNT3 predicts a favorable cancer behavior of neuroblastoma and suppresses malignant phenotypes by modulating mucin-type O-glycosylation and signaling in neuroblastoma cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
17827388 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKYLRHRRPNATLILAIGAFTLLLFSLLVSPPTCKVQEQPPAIPEALAWPTPPTRPAPAPCHANTSMVTH      1 - 70
PDFATQPQHVQNFLLYRHCRHFPLLQDVPPSKCAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQ     71 - 140
LRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGD    141 - 210
DDVFAHTDNMVFYLQDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTA    211 - 280
AALRRAAHVLDIFPIDDVFLGMCLELEGLKPASHSGIRTSGVRAPSQRLSSFDPCFYRDLLLVHRFLPYE    281 - 350
MLLMWDALNQPNLTCGNQTQIY                                                    351 - 372
//

Text Mined References (21)

PMID Year Title
26709519 2015 B3GNT3 Expression Is a Novel Marker Correlated with Pelvic Lymph Node Metastasis and Poor Clinical Outcome in Early-Stage Cervical Cancer.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
24118321 2013 B3GNT3 expression suppresses cell migration and invasion and predicts favorable outcomes in neuroblastoma.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
17827388 2007 Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11439191 2001 Novel sulfated lymphocyte homing receptors and their control by a Core1 extension beta 1,3-N-acetylglucosaminyltransferase.
11042166 2001 Identification and characterization of three novel beta 1,3-N-acetylglucosaminyltransferases structurally related to the beta 1,3-galactosyltransferase family.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10580128 1999 Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions.
10072769 1999 Selection of cDNAs encoding putative type II membrane proteins on the cell surface from a human full-length cDNA bank.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.