Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Gene RIF (1)

AA Sequence

MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQK      1 - 70
FCRDMTFDLRNRTYVHTCCNYNYCNFKL                                               71 - 98
//

Text Mined References (4)

PMID Year Title