Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

Synonym

Accession B3GLJ2 B5KFZ3
Symbols HEL-127
PATE-DJ

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MNKHFLFLFLLYCLIVAVTSLQCITCHLRTRTDRCRRGFGVCTAQKGEACMLLRIYQRNTLQISYMVCQK      1 - 70
FCRDMTFDLRNRTYVHTCCNYNYCNFKL                                               71 - 98
//

Text Mined References (4)

PMID Year Title