Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.79
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 58 13 4.799 2.4

Expression

AA Sequence

MCSPASPKILYRNPRFLRLAFLQLHHQQQSDVFCDVLLQAEGEAVPAHCCILSACSPFFTERLERERPAQ      1 - 70
GGKVVLELGGLKISTLRKLVDFLYTSEMEVSQEEAQDVLSAARQLRVSELESLQLEGGKLVKAPQGRRLN     71 - 140
RECLQPTSAAPISARVVTPSHHPHTPLPTNQTPCPLGAIRLKSLGKEEGPQENNRQNADNLSGTLLLKRK    141 - 210
ARACPTPQEKNSSPSSHSQEPRENKNDTALDPTVLSPPSLYPSVDKHLLPRKIRLSRSKPSPGICTSKPS    211 - 280
SILSGSSSVPATPGRRLWRQRSVNKETPEDKPKPGRASPLQSTPNPSGLGKTGGSRKRSPEVRAPNSDSA    281 - 350
EEGQVGRVKLRKIVNGTCWEVVQETPLKNTQDSPQIPDPGGDFQEPSGTQPFSSNEQEMSPTRTELCQDS    351 - 420
PMCTKLQDILVSASHSPDHPVVKSEFESSPELVEKEPMLAIDCREPYAFDTALLEQPCEAEEYRITSAAA    421 - 490
TSELEEILDFMLCGSDIEPPIGSLESPGAEGCRTPTYHLTETGKNWIEGEEWCLPDMELWPRELTELEKE    491 - 560
PAGENRGPTELLSPLVMPSEVSEVLSVGGRWTPDLEITSSQPLDGQEDKLLHVSSLDTPQRSYGDLSPPC    561 - 630
SNWVETGLEVSLTTDELLYPSPKAGKEVSGHSELLGSLPASSEEEEIDVVDWTAEGRLVPTTVPSVWPDP    631 - 700
SSESETEVDILT                                                              701 - 712
//

Text Mined References (5)

PMID Year Title