Property Summary

Ligand Count 16
NCBI Gene PubMed Count 5
PubMed Score 5.72
PubTator Score 5.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 6.7e-37

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 6.700 6.7e-37

Gene RIF (1)

AA Sequence

MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMYDDIEDILIAT      1 - 70
PLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQRYWKSHPGNPPIYGADISGS     71 - 140
LFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWY    141 - 210
VVPPEHGQHLERLARELFPDISRGCEAFLRHKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGF    211 - 280
NHGFNCAEAINFATPRWIDYGKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVA    281 - 350
ESQELSNWRDDIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT    351 - 420
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLLMGTRSRAQGH    421 - 490
RPQLPLANDLMTNLSL                                                          491 - 506
//

Text Mined References (6)

PMID Year Title