Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.87
PubTator Score 5.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 6.700 0.000

Gene RIF (1)

PMID Text
23092293 Results indicate that the histone demethylase activity is regulated by oxygen availability.

AA Sequence

MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMYDDIEDILIAT      1 - 70
PLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQRYWKSHPGNPPIYGADISGS     71 - 140
LFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFGMWKTTFAWHTEDMDLYSINYLHFGEPKTWY    141 - 210
VVPPEHGQHLERLARELFPDISRGCEAFLRHKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGF    211 - 280
NHGFNCAEAINFATPRWIDYGKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVA    281 - 350
ESQELSNWRDDIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT    351 - 420
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLLMGTRSRAQGH    421 - 490
RPQLPLANDLMTNLSL                                                          491 - 506
//

Text Mined References (6)

PMID Year Title
23092293 2013 Investigations on the oxygen dependence of a 2-oxoglutarate histone demethylase.
21914792 2011 Structural and evolutionary basis for the dual substrate selectivity of human KDM4 histone demethylase family.
21076780 2011 Inhibition of the histone demethylase JMJD2E by 3-substituted pyridine 2,4-dicarboxylates.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.