Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.1e-14
lung carcinoma 2843 5.7e-12

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.700 5.7e-12
psoriasis 2.100 1.1e-14

AA Sequence

MAGSDVDSEGPARRGGAARRPGAPGGPGSEAAAGCPEPLSTAEAPAESATLPAWMRLYFYGMHGITLDVL      1 - 70
VSSARRFARSPDLRMLGFSSPYRCLLHSLTHFALEKVYLQQRRCPNAFVFNFLLYPSAHVGLQTLAGQAL     71 - 140
LLSLGGGAGVAVAPGALDLALQYVLALYHCQVFLKRFLRLRYGRQRRRQQQQQQQQQQQQRRGALPVPPG    141 - 210
ARVPTAAGARRRRPRGPRGAGGAPSQGLPDLPRFLFFGMHGFLDEIFFTFFFNVLGQGDGTTSGHTSLWS    211 - 280
FFMYGSCSFVVEKLYFHLHYSRGWGTWKRVPIYVIFIYVWELSWGLGLRTCGACSWDYSHYPLNFMGLIT    281 - 350
LMYLPGWIFLSVYQDLISNVLWRVQYVPAN                                            351 - 380
//

Text Mined References (5)

PMID Year Title