Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.45

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.06144922730831E-14
lung carcinoma 2844 5.6837427374272E-12


  Differential Expression (2)

Disease log2 FC p
lung carcinoma 1.700 0.000
psoriasis 2.100 0.000

AA Sequence

LMYLPGWIFLSVYQDLISNVLWRVQYVPAN                                            351 - 380

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.