Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.71
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung carcinoma 3.300 0.000
psoriasis -1.300 0.022
facioscapulohumeral dystrophy -1.800 0.025

Gene RIF (4)

PMID Text
22209847 Vwc2l is a novel secreted protein that promotes matrix mineralization by modulating Osterix expression likely through TGF-beta superfamily growth factor signaling pathway.
20468071 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of von Willebrand factor C domain containing protein 2-like (VWC2L; LOC402117) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPG      1 - 70
HSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCE     71 - 140
PSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQ    141 - 210
CSKRECQGKQTV                                                              211 - 222
//

Text Mined References (10)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
22209847 2012 Modulation of matrix mineralization by Vwc2-like protein and its novel splicing isoforms.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19852960 2009 A novel neural-specific BMP antagonist, Brorin-like, of the Chordin family.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.