Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.74
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 8.3e-19
psoriasis 6694 2.2e-02
facioscapulohumeral dystrophy 288 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy -1.800 2.5e-02
lung carcinoma 3.300 8.3e-19
psoriasis -1.300 2.2e-02

Gene RIF (4)

AA Sequence

MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQISSNDNLIFDDYRGKGCVDDSGFVYKLGERFFPG      1 - 70
HSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCE     71 - 140
PSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDECNICHCHNGDWWKPAQ    141 - 210
CSKRECQGKQTV                                                              211 - 222
//

Text Mined References (10)

PMID Year Title