Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Synonym

Accession B2RU33
Symbols A26B2
POTE18
CT104.6
POTE-18

Gene

 Compartment GO Term (1)

 HCA RNA Cell Line (1)

Protein-protein Interaction (7)

AA Sequence

MVTEVCSMPAASAVKKPFDLRSKMGKWFHHRFPCCKGSGKSNMGTSGDHDDSFMKMLRSKMGKCCHHCFP      1 - 70
CCRGSGTSNVGTSGDHDNSFMKTLRSKMGKWCCHCFPCCRGSGKSNVGAWGDYDDSAFMEPRYHVRREDL     71 - 140
DKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKQKRTALHLASANGNSEVVQLLLDRRCQLNVLDNKKRTAL    141 - 210
IKAVQCQEDECVLMLLEHGADQNIPDEYGNTTLHYAVHNEDKLMAKALLLYGADIESKNKCGLTPLLLGV    211 - 280
HEQKQQVVKFLIKKKANLNALDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHH    281 - 350
HVICELLSDYKEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK    351 - 420
KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQLSEEQNTGISQ    421 - 490
DEILTNKQKQIEVAEKKMNSELSLSHKKEEDLLRENSMLQEEIAMLISGDWN                      491 - 542
//

Text Mined References (4)

PMID Year Title