Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2190.43
PubTator Score 0.53

Knowledge Summary

Patent

No data available

 GO Function (1)

 GO Component (2)

Gene RIF (1)

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHSDASVNFSEFSNKCSERWKTMSAKEKGKFEDMAKADKTH      1 - 70
YERQMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYHPKIKGEHPGLSIGDVAKKLGEMWNNTAADD     71 - 140
KQPGEKKAAKLKEKYEKDIAAYQAKGKPEAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEDEEDEEDDDD    141 - 210
E//

Text Mined References (8)

PMID Year Title