Property Summary

NCBI Gene PubMed Count 6
Grant Count 542
R01 Count 310
Funding $67,999,770.1
PubMed Score 1948.79
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Synonym

Accession B2RPK0
Symbols HMG1L1
HMG1L7
HMGB1L1
dJ579F20.1

Gene

 GO Function (1)

 GO Component (2)

 GO Process (1)

Gene RIF (1)

PMID Text
20200978 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHSDASVNFSEFSNKCSERWKTMSAKEKGKFEDMAKADKTH      1 - 70
YERQMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYHPKIKGEHPGLSIGDVAKKLGEMWNNTAADD     71 - 140
KQPGEKKAAKLKEKYEKDIAAYQAKGKPEAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEDEEDEEDDDD    141 - 210
E//

Text Mined References (8)

PMID Year Title
23300278 2013 Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
9925949 1998 Mapping and molecular characterization of five HMG1-related DNA sequences.