Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.74
PubTator Score 1.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (1)

PMID Text
19666007 two novel human C1q/TNF family members, designated as CTRP8 and CTRP9B were described.

AA Sequence

MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGCPGSPGKDGTS      1 - 70
GEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGPQGQKGNKGDVGPTGPEGPRG     71 - 140
NIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGIRGWKGDRGEKGKIGETLVLPKSAFTVGLTV    141 - 210
LSKFPSSDVPIKFDKILYNEFNHYDTAVGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTRDAY    211 - 280
VSSEDQASGSIVLQLKLGDEMWLQVTGGERFNGLFADEDDDTTFTGFLLFSSQ                     281 - 333
//

Text Mined References (7)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21640322 2011 Genetic variants at 13q12.12 are associated with high myopia in the Han Chinese population.
19666007 2009 CTRP8 and CTRP9B are novel proteins that hetero-oligomerize with C1q/TNF family members.
17544811 2007 C1q and its growing family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.