Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
hepatocellular carcinoma 550 1.45122663041531E-5
adrenocortical carcinoma 1427 0.00889367738613737
progressive supranuclear palsy 674 0.0370183671447139
Disease Target Count Z-score Confidence
Melanoma 261 0.0 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
hepatocellular carcinoma 1.500 0.000
adrenocortical carcinoma 1.048 0.009
progressive supranuclear palsy 1.100 0.037

Synonym

Accession B2RD01
Symbols

Gene

  Ortholog (1)

Species Source
Cow OMA EggNOG

AA Sequence

MPGERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTVATIRDSKEKIKASSQI      1 - 70
ATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQPNATLSAAIVQEKAEFDDLQREHGEGSQTERFHASQG     71 - 140
WLVRFKECHCLPHFKMNSAAPSNKDMYTEMLKSIIEEGEYTPQVSLT                           141 - 187
//

Text Mined References (6)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231747 2004 A protein interaction framework for human mRNA degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12136098 2002 NotI flanking sequences: a tool for gene discovery and verification of the human genome.