Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
hepatocellular carcinoma 547 1.5e-05
adrenocortical carcinoma 1428 8.9e-03
progressive supranuclear palsy 676 3.7e-02
Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma 1.048 8.9e-03
hepatocellular carcinoma 1.500 1.5e-05
progressive supranuclear palsy 1.100 3.7e-02

Synonym

Accession B2RD01
Symbols

Gene

  Ortholog (1)

Species Source Disease
Cow OMA EggNOG

AA Sequence

MPGERPTDATVIPSAKRERKAITLDLKLEVLRRFEAGEKLSQIAKALDLAISTVATIRDSKEKIKASSQI      1 - 70
ATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQPNATLSAAIVQEKAEFDDLQREHGEGSQTERFHASQG     71 - 140
WLVRFKECHCLPHFKMNSAAPSNKDMYTEMLKSIIEEGEYTPQVSLT                           141 - 187
//

Text Mined References (6)

PMID Year Title