Knowledge Summary

Patent

No data available

Synonym

Accession B2RBV5
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MRPVDADEAREPREEPGSPLSPAPRAGRENLASLERERARAHWRARRKLLEIQSLLDAIKSEVEAEERGA      1 - 70
RAPAPRPRAEAEERVARLCAEAERKAAEAARMGRRIVELHQRIAGCECC                          71 - 119
//

Text Mined References (3)

PMID Year Title
24248101 2014 Interaction between p12CDK2AP1 and a novel unnamed protein product inhibits cell proliferation by regulating the cell cycle.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.