Knowledge Summary

Patent

No data available

Synonym

Accession B2RBV5
Symbols

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MRPVDADEAREPREEPGSPLSPAPRAGRENLASLERERARAHWRARRKLLEIQSLLDAIKSEVEAEERGA      1 - 70
RAPAPRPRAEAEERVARLCAEAERKAAEAARMGRRIVELHQRIAGCECC                          71 - 119
//

Text Mined References (3)

PMID Year Title