Property Summary

NCBI Gene PubMed Count 338
PubMed Score 7800.22
PubTator Score 5675.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Amyloidosis 67 6.744 3.4

Expression

  Differential Expression (18)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 8.6e-10
Down syndrome 1.300 4.2e-04
glioblastoma 1.600 6.7e-04
interstitial cystitis 1.600 7.2e-03
intraductal papillary-mucinous adenoma (... 1.200 2.1e-02
intraductal papillary-mucinous carcinoma... 1.600 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.800 3.3e-02
juvenile dermatomyositis 1.047 6.8e-14
lung adenocarcinoma -1.100 2.5e-05
lung cancer -1.700 5.0e-05
lung carcinoma -1.500 2.6e-25
osteosarcoma 1.069 9.9e-06
ovarian cancer -1.200 3.4e-04
primary Sjogren syndrome 2.200 1.4e-02
psoriasis 1.500 1.6e-04
Rheumatoid arthritis 2.300 1.9e-02
subependymal giant cell astrocytoma 1.091 3.3e-02
ulcerative colitis 1.100 1.0e-04

PDB (670)

Gene RIF (260)

AA Sequence

MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVE      1 - 70
HSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM                          71 - 119
//

Text Mined References (350)

PMID Year Title