Property Summary

NCBI Gene PubMed Count 13
Grant Count 9
R01 Count 4
Funding $483,001.42
PubMed Score 15.02
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Gene RIF (13)

PMID Text
25945611 Killin has a role in competitively inhibiting the formation of DNA replication forks during S-phase, as well as potentially negatively regulate RNA synthesis during other cell cycle phases
25669429 Germline promoter hypermethylation of KLLN is associated with particular malignant and benign Cowden syndrome features, which is dependent on the PTEN mutation status.
24972837 Nuclear KLLN expression associates with improved relapse-free survival for prostate carcinoma
24356815 Data indicate that NVP-BEZ235-induced androgen receptor (AR) suppression resulted in decreased expression of both tumor suppressor proteins PTEN and KLLN in AR+/ER+ breast cancer cells.
23446638 Germline KLLN mutations dysregulate the cell cycle at G2.
23418309 We demonstrate, in vitro and in murine xenograph models, that both KLLN and PTEN are AR-target genes, mediating androgen-induced growth inhibition and apoptosis in breast cancer cells.
23386643 KLLN is a transcription factor directly regulating AR, TP53, and TP73 expression, with a role in prostate carcinogenesis.
22580995 Pathogenic mutations in KLLN are rare in breast cancer families and the c.339_340delAG variant does not represent a high-penetrance breast cancer risk allele.
21956414 Cowden syndrome patients have elevated risks of papillary thyroid cancer from KLLN alterations.
21584899 19 of 20 advanced RCC showed somatic hypermethylation upstream of KILLIN
More...

AA Sequence

MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTTFRRRSRVSLV      1 - 70
GELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPN     71 - 140
TCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD                                    141 - 178
//

Text Mined References (14)

PMID Year Title
25945611 2015 Cell cycle specific distribution of killin: evidence for negative regulation of both DNA and RNA synthesis.
25669429 2015 KLLN epigenotype-phenotype associations in Cowden syndrome.
24972837 2014 Nuclear KLLN expression associates with improved relapse-free survival for prostate carcinoma.
24356815 2014 Activation of AR sensitizes breast carcinomas to NVP-BEZ235's therapeutic effect mediated by PTEN and KLLN upregulation.
23446638 2013 Germline and somatic KLLN alterations in breast cancer dysregulate G2 arrest.
23418309 2013 Androgen receptor-induced tumor suppressor, KLLN, inhibits breast cancer growth and transcriptionally activates p53/p73-mediated apoptosis in breast carcinomas.
23386643 2013 Transcription factor KLLN inhibits tumor growth by AR suppression, induces apoptosis by TP53/TP73 stimulation in prostate carcinomas, and correlates with cellular differentiation.
22580995 2012 Analysis of KLLN as a high-penetrance breast cancer predisposition gene.
21956414 2011 Incidence and clinical characteristics of thyroid cancer in prospective series of individuals with Cowden and Cowden-like syndrome characterized by germline PTEN, SDH, or KLLN alterations.
21584899 2011 Germline and somatic DNA methylation and epigenetic regulation of KILLIN in renal cell carcinoma.
More...