Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.19
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.77108829405153E-4

Synonym

Accession B1ATL7
Symbols CXorf64

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

AA Sequence

MACIENVLGGHAPSPLVVSVDKNGNQELHHDMPLQCLSSKPEDDAEPWGQPQVPLRPSVNVLTDLDSKQL      1 - 70
EWPSERTGSCIPLHSLRAHRHPYGPPPAVAEESLATAEVNSSDALAGWRQEGQDAINVSWEVSGGPPALI     71 - 140
VGGTKVNNGGTERGSNNARLHVALPQGKGFFPPRGPQVRGPSHIPTLRSGIVMEVPPGNTRIACRGKLAH    141 - 210
VSFPLRGPCHPMHNWPRPIPLSSSTPGLPSCSTVHCFIPPRPPIFNPFLTMPLPFAPPPIFGPPLPSYFA    211 - 280
HFHSGGMPAPASPNREHS                                                        281 - 298
//

Text Mined References (3)

PMID Year Title
21375368 2011 Differential gene expression in patients with amyotrophic lateral sclerosis.
15772651 2005 The DNA sequence of the human X chromosome.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.