Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma -1.066 6.6e-04
ependymoma 1.600 1.5e-07
group 4 medulloblastoma -1.100 3.4e-03
medulloblastoma, large-cell -1.400 6.2e-03
nasopharyngeal carcinoma -1.200 2.1e-05
osteosarcoma -2.187 9.1e-09
tuberculosis 1.200 1.3e-03

AA Sequence

MASRPRPRTPSRGPSDLRFRGEAGLRRVFLKKAGGSVSFSDVAVGFTQEEWQHLDSAQRTPYRDMMLENY      1 - 70
SLLLSVGYCITKPEVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLT     71 - 140
MDRNGVLGKTFSLDTNPILSRKIRGNCDSSGMNLNNISELIISNRSSFVRNPAECNVRGKFLLCMKRENP    141 - 210
YARGKPLEYDGNGKAVSQNEDLFRHQYIQTLKQCFEYNHRGYTEERNPMNALNVGKLLDIGHALQYIKEH    211 - 280
TRDKTYECNECGKNFCEKSNLHVHQRTHTGEKPYGCNECQKAFGDRSALKVHQRIHTGEKPYELHQRTHT    281 - 350
GEKPYACSECGKTFYQKSSLTTHQRTHTREQPYEYNESFYQNPNFTKCQRDNIEETLVNILKAQKPSPSW    351 - 420
TRSIAETTQVGGSVSLKDVTVDFTQEEW                                              421 - 448
//

Text Mined References (2)

PMID Year Title