Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

AA Sequence

MASRPRPRTPSRGPSDLRFRGEAGLRRVFLKKAGGSVSFSDVAVGFTQEEWQHLDSAQRTPYRDMMLENY      1 - 70
SLLLSVGYCITKPEVVCKLEHGQVLWILEEESPSQSHLDCCIDDDLMEKRQENQDQHLQKVDFVNNKTLT     71 - 140
MDRNGVLGKTFSLDTNPILSRKIRGNCDSSGMNLNNISELIISNRSSFVRNPAECNVRGKFLLCMKRENP    141 - 210
YARGKPLEYDGNGKAVSQNEDLFRHQYIQTLKQCFEYNHRGYTEERNPMNALNVGKLLDIGHALQYIKEH    211 - 280
TRDKTYECNECGKNFCEKSNLHVHQRTHTGEKPYGCNECQKAFGDRSALKVHQRIHTGEKPYELHQRTHT    281 - 350
GEKPYACSECGKTFYQKSSLTTHQRTHTREQPYEYNESFYQNPNFTKCQRDNIEETLVNILKAQKPSPSW    351 - 420
TRSIAETTQVGGSVSLKDVTVDFTQEEW                                              421 - 448
//

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.