Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession B1ANY3
Symbols C9orf51

Gene

 Compartment GO Term (0)

AA Sequence

MRDRRGPLGTCLAQVQWAGGGDSDKLSYSLKKRMPTEGPWPADAPSWMNKPAVDGNSQSEALSLEMAGLS      1 - 70
LPSGGPVLPYVKESARRNPASAATPSAAVGLFPAPTEYFARVSCSGVEALGRDWLGGGPRATHGHRGQCP     71 - 140
KGEPRVSRLTRHQKLPEMGSFWDDPPSAFPSGLGSELEPSCLHSILSATLHACPEVLLKDETKRIFLDLL    141 - 210
NPMFSKQTIEFKKMFKSTSDGLQITLGLLALQHFELANSLCHSLKYKQNNASRLILRVVLE             211 - 271
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.