Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19626040 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDIRKEKRLNMALQMSNFKKALNRFEKLVEQTAAQKRDERAGLFIHKEDAIGYDKFYASVQKLFGPDVKN      1 - 70
QDVKRFYRKLCNNTDASADWCEIFGYFSSEEDPIASQLDEENLVFFVSRKRRILISGSRRRDVIKSIVKI     71 - 140
PHLDLLITATQKGLITVFNNQDTSWITGCDYLLQLKRIVATTERTIIVWDYKAQGSSQENYFVIKPMDHC    141 - 210
LLCVCVVPLPDHLCRDDILLGDDGGFVNRFTVNSDDFGIKQAKSKRKLQNQVLDSKNFKSVKRKLHNDWV    211 - 280
MKIRYISALNCFGSCSLDSNHSLVLESLKRLEDNLPVREFSMPRGANTFCYCVKANVIVTGGDDKVIRLW    281 - 350
HPNISTKPVGKLVGHMFSIAEIVTNEKDQHVVSLSSAKVFRVWDIQTLSLLQVFHDSQGGPGDMQIYSMI    351 - 420
YDANHGMLITGSSVMDMYPLTRMIQDTKQVPHTHEREINVMLYNKYFHQVLTICSESIIRVWELETGLQV    421 - 490
YQILEPHGFNTEVTSAAVDESGFLFATGAYNGTVRIWDFGSGQEMKVLPEGKDWKEDEHCLRRLIFLKAQ    491 - 560
EKHQQLVLALERNGTIKMIQGKEDDIYLMVIWELPDVVPFLQDGKHAVHLRMSTRDRNMAIPFPDVELIV    561 - 630
ERNFSQPTDNPTMDLLRVNCIDLLQVEGYNLIAAGTLNGVIILWNFVTSTVKKVYRPEDCFTVNPDLHPK    631 - 700
HFKINDILFLFRTPECARRSSQDSICSSSQCESSKGPQSSKGSKQSIHDSEVKGEQTDVMVGKQQPMDKK    701 - 770
HPGIANLPEAQPPILVTAHEDGHLRLWTLEGRLLKDMLPFTKHSAISLTSLYTDSCTRILLAGNVEGHVI    771 - 840
LCNISSFLDPPHDEKKFKQLLSWRAHSLEIIQVIYVEEKQVVLTASIDGSVRLWHALNGHYCGYFGQRRL    841 - 910
FELSQTRDFILPCDVTEYPIEIKEESKFTEKQKYEYPLIFDREKWRKMSSVSLLFKRTPPKAFEVEQDFK    911 - 980
FFKSLSSPKIRRYPLEGFVTENREAGIVFGSLPIYSISSPTSLRFLPLIGVEAQKDSSDGITGKKKGGHV    981 - 1050
QREKAPRRRSLKKNLVPQINLASSFFPAIPK                                          1051 - 1081
//

Text Mined References (6)

PMID Year Title
23942779 2013 A genome-wide association study of behavioral disinhibition.
20923822 2010 Radiation pharmacogenomics: a genome-wide association approach to identify radiation response biomarkers using human lymphoblastoid cell lines.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19626040 2009 Follow-up examination of linkage and association to chromosome 1q43 in multiple sclerosis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.