Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

Synonym

Accession B1ANH7
Symbols C1orf148

Gene

 Compartment GO Term (1)

AA Sequence

MTYPPHRAFSRSDVPYPLLSSPVQWPLSLVVGDTSTRWPQQPSALESDCPGPSHPCLAGLLGPMHPVDIP      1 - 70
LSTALHSKHQRRLTQCVLMVQSPSKQRSLYLLNKKIPHDA                                   71 - 110
//

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.