Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 4.37680772898568E-7



Accession B1ANH7
Symbols C1orf148


 Compartment GO Term (1)

AA Sequence

LSTALHSKHQRRLTQCVLMVQSPSKQRSLYLLNKKIPHDA                                   71 - 110

Text Mined References (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.