Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 4.4e-07

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.067 4.4e-07

Synonym

Accession B1ANH7
Symbols C1orf148

 Compartment GO Term (1)

AA Sequence

MTYPPHRAFSRSDVPYPLLSSPVQWPLSLVVGDTSTRWPQQPSALESDCPGPSHPCLAGLLGPMHPVDIP      1 - 70
LSTALHSKHQRRLTQCVLMVQSPSKQRSLYLLNKKIPHDA                                   71 - 110
//

Text Mined References (2)

PMID Year Title