Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 4104 3.3e-02

Expression

AA Sequence

MQFADWLHPSGWTIEILNAYGMGDRKRTNSMSKEAFTPEQLHLEKELGEMRLRPTVLHSQTDHQGFRPIP      1 - 70
MMQ                                                                        71 - 73
//

Text Mined References (4)

PMID Year Title