Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.33
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -4.400 0.000
astrocytoma -1.400 0.000
glioblastoma -3.200 0.001
osteosarcoma -1.379 0.013
posterior fossa group B ependymoma -2.600 0.000
medulloblastoma -2.000 0.002
cystic fibrosis 2.517 0.000
atypical teratoid / rhabdoid tumor -4.300 0.000
medulloblastoma, large-cell -3.700 0.000
primitive neuroectodermal tumor -1.900 0.011
fibroadenoma 1.900 0.000
interstitial cystitis -2.000 0.005
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -1.100 0.005
spina bifida -2.409 0.042
ovarian cancer -3.200 0.000
facioscapulohumeral dystrophy 1.800 0.027

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCAEAKLTRARDK      1 - 70
EHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGG     71 - 140
GGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSK    141 - 210
HPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYE    211 - 280
EFESVLHKYLQSEEYSVKSCPEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDE    281 - 350
VIYGGLSSFICTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLC    351 - 420
VLVLILLHTVLTASAAQNTAGLSFGGINTLEENSTNEE                                    421 - 458
//

Text Mined References (17)

PMID Year Title
25208829 2014 Genome-wide association study of vitamin D levels in children: replication in the Western Australian Pregnancy Cohort (Raine) study.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23738518 2013 A genome-wide association study for reading and language abilities in two population cohorts.
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21079607 2011 A genome-wide association study on common SNPs and rare CNVs in anorexia nervosa.
20800221 2010 Genome-wide association scan of trait depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
More...